KEGG   Sordaria macrospora: SMAC_03322Help
Entry
SMAC_03322        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
smp  Sordaria macrospora
Brite
Protein kinases [BR:smp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SMAC_03322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2496 aa AA seqDB search
MSLTKEQAAATLETHIRDVRNRTSTDDARKRAARQIRDLVNVAKQGKSSCFQILLRFPSE
MGAEQFTAFFNTVNQRTMALIQGTDTCDRMGGVYILDALVDFDGIDLALKYSRFEQHIGY
ILRSKDVTPMQPAAVVLGKLCKPGGSLISELVDAEVKLALEWLQSERVEERRYAAVLILR
ELARNAPTLMYPYVNFVFEQSWIGLRDQRLLIRATSAETVSACFKIIRERDQAMKQEWMD
KMFHEANRGLKTNTVESVHASLLVLKELLEQGGMYMQTHYGEACDIVFRHKDAKDPAIRK
TVVLLIPDLANYAPNDFASTYLHKFMIHLSHMLKKEKERNDAFLAIGNVANSVKSAIAPY
LDDVLIYVRDGLSIQSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACELTPKL
TQALVDMAFYIPPVKATIQERLLDMLSKVLCGEPFRPLGAPHPNTLTSIPAIPKDPKDPS
VQERGKAEVKLALNTLGSFDFSGHVLNEFVRDVAIKYVEDDDPEIREAAALTCCQLYVRD
PIVNQTSYHALQVVADVIEKLLTVGVSDPDAAIRRTVLAALDERFDQHLAKAENIRTLFF
ALHDEVFAIREVAVSIIGRLARYNPAYVIPQLRKTIIQMLTELEYTDVARSKEESSKLLS
LLTQHAQDLVKPYVNSITEVLLPKARDPTPSVAATVLQAIGELCTVGGESMLAYKDTLMP
IIIDALQDQSAPIKREAALHTLGQLASNAGYVIQPYLEYPQLLEILQTIIRGEPQHGTLR
QETIKLMGILGALDPYKHQRASPMKDSMASLMGKFASARSRNPSDKTHNPLKNALANLMQ
VEERTDDNKNEAAQLTDVSLMMSGLTPSNEDYYPTVVINALLQILKDQSLVQWHGNVVDA
IMSIFITLGLKCVQFLDRVVPAFISVIRASSNSRLEFYFNHLSRLVSIVRQHIRVYLKDI
IDVLQEYWHTTLALQSTILGLIESISRSLEGEFKIYLAKLLPLMLGVLEKDVSTKRQPSE
KVFHAFLVFGSSAEEYMHLIIPVIVRLFDSHSQPMFLRKSAIETIGKLSSMVNLNDYASK
IIHPLTRVLASGEPSLRVAALDTLCALMLQLGRDYLHFEHTVDKAISMYAIQHSNYEKAI
EKLKKGEALSQNLAPRFEDISMEGFAAENNPPKKLTLNPVHLKQVWETKGKSTKDDWHEW
FRKFSTTLLTESPNHSLRACASLASNYQPLARELFNSAFVSCWSELYEQFQEDLITNIEN
TIKSENVPPDLLGQLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHYKELEFLQD
HNSGAVEALIVINNQLQQSDAAIGILRKVKTYREGIQLRESWFEKLERWDEALNFYCQRE
REIPEDQPVPVDIVMGKMRCYHALGEWDSLATLAGKTWANSSPEIQRRIAPLATTAAWGL
GKWDSMDSYLQSMKRFSPDRAFFGAILALHRNQFREAMACIEQAREGLDTELSALVSESY
NRAYQVVVRVQMLAELEELIVYKQTDGEKQATMRRTWETRLKGCQRNVEVWQRMLRLRSL
VMTPQENMHMWTKFANLCRKSGRMGLAEKSLKQLIGTDSSLDSVIPYWHDRHPGPAGSRI
ASPILYAVLKFQWEIGQSPGFRNSEHRVAEKTLYCLQRFTQETAHRVEASRMHMATHAQN
GMEVQNQPGFAEFNEEMLHPQAQKHWLEQTVLLAKCYLRQGEWMVSLNKDDWQQRYRAEV
LDCYYKATHYNNKWYKAWHAWALANFEVVQYLTANREVDVRNNGEQNYIIQYVVPAVRGF
FESIALSSGSSLQDTLRLLALWLTHGGHIDVHNAVTEGFTRVSVDTWLEVIPQLIARINQ
PHKRVQQSVHGLLADVGRAHPQALVYPLTVARKSWHNTRRVRSANQILESMRQHSLRLVE
QAEIVSGELIRVAVLWHELWHEALEEASRLYFGDHNIEGMFATLEPLHELLEAGPQTLRE
ISFAQTFGRDLSEARDWCRQYQETQDSNDLNQAWDLYYTVFRRITRQLPQMTSLELAYCS
PNLLNAKDLELAVPGTYRSGQEVVRIMSFDATFSVISSKQRPRKLDIVGSDGKTYTFLLK
GHEDIRQDERVMQLFGLCNTLLANDSESFKRHLNIQRYPAIPLSQNSGLLGWVPNSDTVH
QLIREYRDSRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQDLYRVLWLKS
KSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKIIHIDFGDCFEVAMK
REKYPERVPFRLTRMLTYAMEVSNIEGSFRTTCEHVMRVLRENKESVMAVLEAFIHDPLL
NWRLTNPTSPPGPNFTAEREVAMPGGPGPRARRPSILDAPVAPTEFLAAQAAPGADGHGM
GMSANPGRSRARTNSSAIYPTGSSMVNGHGNNQQEQQEVQNARALEVLDRVQQKLTGRDF
KPHEELNVTDQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7491 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaccaaggagcaagcagcggcaacgctggaaacacacattcgcgatgtgagg
aatcgcacctctaccgacgacgcccggaagcgcgctgctcggcagatcagagatctcgtc
aatgttgcaaagcaaggcaagtcatcatgttttcagattctcctcagatttccatctgaa
atgggcgccgagcagtttacggcattcttcaacacagtcaaccagaggaccatggcgctt
atacaagggaccgacacctgcgatcgaatgggcggtgtctacatcctcgatgccttggtt
gacttcgatggtatagacctagccctcaagtacagtcgcttcgagcagcatattggctac
atcctccgcagcaaagatgtaacgccaatgcagcctgccgcggttgtcttgggaaagctt
tgcaagcctggtggctctctcatctcagagcttgttgatgctgaggtcaagctcgctttg
gagtggcttcagtcagagcgagttgaggaaaggcgatatgccgccgtcctcattctacgc
gagctggcacggaatgcaccaaccctgatgtacccgtacgtcaacttcgtattcgagcag
tcctggatcggccttcgagatcagcgactcttgatccgagctacttctgccgagaccgtc
agtgcctgcttcaagattataagggagcgtgatcaggccatgaagcaggagtggatggac
aagatgttccatgaagcaaacaggggactcaagaccaacaccgtcgagtcagttcatgct
tctcttttggttctcaaagagctgctagagcagggcggcatgtacatgcaaacccattac
ggcgaggcatgcgatatcgtcttccgtcacaaggacgccaaggatccggctattcgtaag
accgtggtcctcctcatccccgacttggccaactacgcaccaaacgacttcgcatcaaca
tatctccacaaatttatgatacatctttctcacatgcttaagaaggaaaaggaaagaaac
gatgcgtttctcgccatcggcaacgttgccaactcagtcaagagcgccatcgccccctat
cttgatgacgtcctcatatatgtccgggacggcctaagtatacagtctagaaagcgtggc
tcggtcgaccccgtctttgattgcattagccgtttggccgtggccgtgggtcagaccttg
agcaaatatatggaagcgctcctggatcccatctttgcctgcgagcttacgcctaaacta
acacaggccttggttgacatggccttctacatcccccccgtcaaggctactatccaggaa
cggttgctcgatatgcttagcaaggtattgtgcggagaacccttccgaccgctgggagca
cctcaccccaacacattgacctcgattccggccatccccaaagaccccaaggacccatca
gtacaggaacgtggaaaggccgaagtcaaactggctttgaacacccttggtagttttgac
ttttcaggacatgtcttgaatgagttcgtccgcgacgttgctataaaatacgttgaagac
gacgatccagagatccgtgaggcagctgctctaacgtgctgtcaactttacgtgcgcgac
cccattgtcaaccagactagttaccatgcgctccaggtggtcgcagatgttatcgagaag
cttttgacagtcggcgtgtcggatcctgatgccgctatcagacgtacggtcctggcagcc
ctcgacgagcgcttcgatcagcacctagccaaggctgaaaatatccgtaccttgtttttc
gccctccacgacgaagtattcgctatcagagaagtcgccgtctcgatcatcgggcgtctg
gctcggtacaacccggcctatgtcattcctcagttgcgaaagacaattattcagatgcta
actgaactggaatacacggacgtggccaggagcaaagaggagagctccaagttgctgagt
ctgcttacgcagcacgcccaggacctggtcaagccctacgtgaactccatcactgaagtc
cttctaccaaaagcgcgtgatcccaccccttctgtggccgcaacggtccttcaagcgatc
ggagagttgtgcacagtcggtggagaatccatgcttgcttacaaggacacattgatgccc
atcatcattgacgccctgcaggatcaaagtgctcctatcaagcgggaggctgccctccac
acccttggccaacttgctagcaacgctggctatgtcattcaaccttatctcgaataccct
caacttctcgagatccttcagacgatcatccgcggcgagccccaacacggcacattacga
caggaaacgatcaagcttatgggcattttaggcgctctggacccgtataaacatcagcga
gccagtcctatgaaggacagtatggccagcctaatgggcaaattcgcgagtgcgaggagc
agaaacccctcagacaaaacacataatcccctcaaaaacgcgttggctaacttaatgcag
gtcgaggaaaggacggatgacaacaagaacgaagcggcccaactgaccgatgtctctttg
atgatgagtggcctaacaccatctaatgaagactactatccaacagtggtgatcaatgca
ctacttcagatactaaaggatcagtctttagtccagtggcacggaaacgtcgtcgatgcc
atcatgagcatcttcatcactctggggctgaagtgtgtacaatttcttgatcgtgtggtt
cccgccttcatatcagtcatccgtgcctcgagcaattcccgcctcgagttctacttcaac
cacttgagcagactggtcagcatcgtacgccagcatatccgagtatacctcaaagacatc
attgatgttctccaagagtactggcacacaactctcgcgcttcagagcaccatcctggga
ttgatagagtcaatctcgcggtctcttgaaggcgagttcaagatctaccttgccaagttg
ctcccgcttatgctaggcgtgctcgaaaaggatgttagcacaaagcggcagcctagcgag
aaagtcttccatgcgttcctggtgttcggctcaagcgccgaagagtacatgcacctgatc
atcccagtcattgtacgcctcttcgacagtcacagccagcccatgttccttcgaaaatcg
gctatcgagacgatcggcaagctttcgagcatggtgaacttgaacgattacgcatcgaag
atcatccatccccttactcgtgtactggctagcggcgagccgagtctccgggtggccgct
ttggatactctttgcgcccttatgttgcagctcggacgcgattacttgcatttcgagcac
acagtcgacaaggccatctctatgtatgccattcagcattcgaactatgaaaaggcaatc
gagaagctgaagaagggcgaggccctttcacaaaacctcgcccctcggtttgaagacatt
tccatggaaggctttgctgccgaaaacaacccacccaagaagttgaccctgaatccggtg
catctcaaacaggtgtgggaaacgaagggcaagtctaccaaggacgattggcatgagtgg
ttcaggaagtttagcacaactctcctaaccgagtcgccgaatcactccttgcgtgcttgt
gccagcttggccagcaactaccagcctcttgcgcgtgagctcttcaactcggctttcgta
tcatgctggagcgagctttatgaacagttccaggaggatttgatcaccaacattgagaat
acgatcaagtcagaaaacgtaccaccggatctccttggccagctcctcaaccttgctgaa
ttcatggagcacgatgacaaggcgctgcccatcgacattagagttttgggccgcgaggcc
gcccgttgccacgcatacgcaaaggctcttcactacaaggagcttgagttcttgcaggac
cataacagtggtgcagttgaggctctgattgtcatcaataaccagctccagcaatccgat
gctgccatcggtatcctccgcaaagttaagacctacagggagggtattcagttgcgtgag
agttggttcgagaagctcgagcgttgggacgaggctctcaacttctactgccaacgcgaa
cgcgagattccggaagaccagcctgtacccgtggacattgtgatgggcaaaatgcgctgt
tatcatgctcttggcgagtgggattccctagctacgcttgctggaaagacctgggccaat
tcgtcacctgagattcagagacgcattgctccactggcgacaaccgcggcctggggtctc
ggcaagtgggactccatggacagctaccttcagtcaatgaagcgcttctccccagacaga
gccttctttggtgcgattctcgcccttcaccgcaatcagtttagggaggctatggcatgc
attgagcaagcccgcgaaggactagataccgagcttagtgcgcttgttagcgagtcttac
aaccgggcttatcaggttgtagtacgcgttcaaatgctcgcggagctggaagagctcatt
gtctacaagcaaaccgacggagaaaagcaggctaccatgcgcagaacctgggagactcgt
cttaagggctgccagcgcaatgtcgaggtatggcaacgcatgctgcgcttgaggtcgctt
gtcatgactccgcaggagaacatgcatatgtggaccaagttcgccaacctttgtcgcaag
tcgggccgcatgggactcgctgaaaagtcactcaagcagcttattggaaccgactcatcg
ttagactctgtcattccttactggcatgatcgccatccgggccccgctgggagcaggatc
gcgtctccgatcttgtatgcggttctgaagttccagtgggagattggacagtcgccagga
ttccgcaattcggagcatagggtcgccgagaagacgctgtactgcctgcagaggttcacg
caggagactgcgcatcgcgttgaagcctcgcgtatgcatatggctacccatgctcagaac
ggcatggaggtgcagaaccaaccagggtttgccgagttcaacgaagagatgctgcatcca
caggcgcagaaacactggctcgagcagactgtcttgcttgccaagtgctatctccgccaa
ggcgaatggatggtctcgctgaacaaggacgactggcaacagaggtaccgcgctgaggtc
cttgactgctactacaaggctactcattacaacaacaagtggtataaggcctggcacgca
tgggccctggccaactttgaagtcgttcagtacctgacagcgaaccgtgaggtggatgtg
cgcaacaatggggagcagaactacatcattcagtatgtggttcctgctgttcgcggattc
ttcgagtctattgcattgtcctctggcagctctctgcaggacactctgcgcctcttggcc
ttgtggctcactcatggtggccatatcgacgtccataacgccgtcaccgaaggcttcacg
cgtgtcagcgttgatacctggcttgaggttattccccagttgattgccaggatcaatcag
ccgcacaagagggtccagcagtctgtccatgggttgttggccgatgttggccgtgctcat
ccccaggcgctggtgtatccgttgacggtagcaaggaagtcttggcacaacacgcgtaga
gttcggtcggccaaccaaattcttgaaagcatgcgtcaacacagtctccggctcgttgag
caagctgaaatcgtcagtggtgagcttatccgcgtcgctgtgctatggcatgagttgtgg
catgaggctctcgaggaggcttcgcgcttgtacttcggcgaccacaacattgagggcatg
tttgccactctcgagccgcttcacgagttgctggaggctggcccgcaaactctcagagaa
atctctttcgcccagacctttggccgtgacctgagcgaagctcgggattggtgccgtcaa
tatcaagagacacaagactccaatgaccttaaccaggcatgggacctttactacacggtg
ttccgtcgcatcacccgtcaacttccacagatgacctccctcgagttggcttactgctcg
cccaacttgttgaacgccaaggatctcgaacttgctgtgcctggaacataccgcagtggc
caggaggttgttagaatcatgtcctttgacgccaccttcagcgtgatcagctccaagcaa
cggcctcgcaagctcgatatcgttggtagcgatggcaagacatacaccttccttctcaag
ggacacgaagatatccgtcaggatgagcgtgtcatgcagctctttggtctttgcaacaca
ttgttggccaacgactccgaaagcttcaagcgacatctcaatatccagagataccccgcc
attcctctttcacagaactctggtcttctcggctgggtccccaacagtgacactgtccat
cagttaattcgggagtacagagattcgagaaagattctcctcaacatcgaacatcgtatc
atgttgcagatggctcctgactacgacaaccttacgcttatgcaaaaggttgaggtcttc
ggttacgctcttgacaataccactgggcaagatctgtaccgtgtcctgtggttgaagagc
aagtcgtctgaggcctggctggatcggagaaccaactacacacgttctctcggtgtcatg
tcgatggtcggctatatccttggcttgggtgatcgccatcctagcaacttgatgcttgac
cgcattacgggcaagatcattcacattgatttcggtgactgcttcgaagtagccatgaag
cgcgagaagtaccctgagcgggtgccgttcagactgactcgcatgctcacatatgctatg
gaagttagtaacattgagggtagtttccgtaccacttgtgagcatgtgatgagggtgttg
cgcgagaacaaggagagtgtcatggctgtccttgaagctttcattcatgatcctttgctc
aattggcgtttgaccaatcccaccagcccgcctggtcccaacttcaccgccgagcgggag
gtcgccatgcccggaggtcctggcccgcgcgcccgcaggccgtctatccttgacgctccc
gtggcgcccaccgagtttctcgcagcgcaagctgcccctggcgcagatggtcatggaatg
ggaatgtccgctaaccccggacgctcccgtgcccgcaccaactcgtctgcgatctacccg
actggcagcagcatggttaatggccatggcaacaaccagcaagagcaacaggaagttcag
aacgcccgtgctcttgaggtcttggatcgcgtgcaacagaagctcactggtcgcgacttc
aagcctcacgaggagctcaacgtaaccgatcaagttaacaagctgatcatcgaggctacc
aagctggagaacttgtgccagcattacattggatggtgcagtttctggtaa

DBGET integrated database retrieval system