KEGG   Sordaria macrospora: SMAC_03490Help
Entry
SMAC_03490        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smp  Sordaria macrospora
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMAC_03490
Enzymes [BR:smp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SMAC_03490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MSQKTPVFLLKTKSTPGDSYQEQFSSETDGFNFEPFFVPVLEHRFKDEGLATVRNLLKTR
AIGTSPDCAYGGMVFTSQRAVEAFTHLVQEVTGDERWPHLQDIPVYSVGPATTRALKAVP
QQPPLQVFGEHTGNGETLAPYIIEHYGEWYKDRATKPPLLFLVGEQRRDIIPKKLMDPAL
PSDKFIRIDEVVVYGTGVMESFQQDFTKLLKDTEDRPVRWVVVFSPSGCDGMLSALGWLN
ESSGRVEGKVQKEDRKTYIATIGPTTRLHLVNNFGYEPDVCAEQPSPEGVWEGINRFWNE
SKK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaagacgcccgttttcttgctcaagacaaaatcaactcctggggattcgtac
caggagcaattctcctccgagacggatggcttcaattttgagcccttctttgtccccgtc
cttgaacatcgattcaaggacgagggcctagctacggtacgcaaccttctcaagacgaga
gctatcggaaccagtcccgactgcgcctatggtggtatggtcttcacctcccaacgcgct
gttgaagctttcacccaccttgtccaggaagtaacaggcgatgaaagatggccccatctt
caggacatccctgtgtacagcgtcggccctgcgacaacccgcgcgttgaaggcagttccc
caacaaccaccgctccaagtctttggtgagcatactggcaacggtgaaacattggcaccc
tacatcattgaacattatggcgaatggtataaggaccgagccaccaagccgccgctgttg
ttcctggttggcgaacaaagacgggacatcattcccaagaagttgatggatcctgctttg
ccatcagacaagttcatccgcatcgacgaggttgtcgtctatggtaccggtgttatggag
tccttccagcaagatttcaccaagcttctcaaagacaccgaagaccgtccggtcagatgg
gtggtggtcttctccccaagcggctgcgacggcatgcttagtgccctgggatggctgaac
gagagcagtggcagagtggaagggaaggtccagaaggaggaccgtaagacgtacattgct
accatcgggccgacaactcggcttcatcttgtcaacaactttggctatgagcctgatgtc
tgcgcggagcagcccagcccggaaggggtttgggagggcattaataggttttggaacgaa
tcgaagaaataa

DBGET integrated database retrieval system