KEGG   Sordaria macrospora: SMAC_03503Help
Entry
SMAC_03503        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
MNAEDLALDANLSKFKEESRPLSPPLRGHLLSTSSWIRVAHNHFARRLDLLNAALALENK
VEESKKKRAKTTARRKKNQEIEDAYHFVAYVPNHRDRSVWELDGLKFNPRYVGKFEEGAH
WTSIVQPVIQEKMMEYEDSQLAFSLLALCGDRLASLRRQLALNIHYTKLLNDAFGKESAW
FKEDDGSSSCKDHISNFSDKSKLDEFQLSADEVQLIIKGSSDGLRLQDKIQVGGMEMAEA
LLFRTELRQKQEQLRSGYYTEVASGPEGDEDGDSQDEDPGRRKDHTPAIHEWVTKLAERG
MLKELHEQVKARNGS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagaagacctcgcactggacgccaacttgtccaagttcaaggaggaatctaga
cccctatctccacccttgcgcggccacctgctcagtaccagttcgtggataagggtagct
cataatcattttgcaaggcgtttggacctcctcaacgcagccctggctctcgagaacaag
gtcgaggaaagcaaaaagaagcgggctaaaaccacagcgcgccggaagaagaatcaagaa
atcgaggatgcctatcactttgttgcatatgtgccaaatcaccgggaccgtagcgtgtgg
gaactcgatgggctgaagttcaaccctcgctacgtcggaaaattcgaggaaggtgcgcac
tggacgagtatagtccagcctgtgatccaggaaaagatgatggagtacgaggacagtcaa
ctggcgtttagcctcctggctctttgcggagaccgtctggcctcactgcggcgtcaactc
gctctcaacatccattacacgaaactgctgaatgatgcattcggaaaagagtctgcatgg
tttaaagaagacgacggctcgtcttcatgcaaggaccatatcagcaacttcagcgacaag
agcaaactggacgagttccagctcagtgccgacgaagttcaactcatcatcaagggttca
tcggacgggcttcggttgcaagataaaatacaagtgggtggtatggaaatggccgaggcg
ctgctttttagaacggagctccgccagaagcaggagcagcttcggtcggggtattacaca
gaagtcgcgtctgggccggagggagacgaggacggtgattctcaggatgaagatcccgga
cgaaggaaagaccacacaccagccatccatgaatgggtaaccaagcttgccgagcgtggt
atgctgaaggagcttcatgaacaggtaaaagcgcgaaacggttcataa

DBGET integrated database retrieval system