KEGG   Sordaria macrospora: SMAC_03503Help
Entry
SMAC_03503        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SMAC_03503
Peptidases [BR:smp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SMAC_03503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
MNAEDLALDANLSKFKEESRPLSPPLRGHLLSTSSWIRVAHNHFARRLDLLNAALALENK
VEESKKKRAKTTARRKKNQEIEDAYHFVAYVPNHRDRSVWELDGLKFNPRYVGKFEEGAH
WTSIVQPVIQEKMMEYEDSQLAFSLLALCGDRLASLRRQLALNIHYTKLLNDAFGKESAW
FKEDDGSSSCKDHISNFSDKSKLDEFQLSADEVQLIIKGSSDGLRLQDKIQVGGMEMAEA
LLFRTELRQKQEQLRSGYYTEVASGPEGDEDGDSQDEDPGRRKDHTPAIHEWVTKLAERG
MLKELHEQVKARNGS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagaagacctcgcactggacgccaacttgtccaagttcaaggaggaatctaga
cccctatctccacccttgcgcggccacctgctcagtaccagttcgtggataagggtagct
cataatcattttgcaaggcgtttggacctcctcaacgcagccctggctctcgagaacaag
gtcgaggaaagcaaaaagaagcgggctaaaaccacagcgcgccggaagaagaatcaagaa
atcgaggatgcctatcactttgttgcatatgtgccaaatcaccgggaccgtagcgtgtgg
gaactcgatgggctgaagttcaaccctcgctacgtcggaaaattcgaggaaggtgcgcac
tggacgagtatagtccagcctgtgatccaggaaaagatgatggagtacgaggacagtcaa
ctggcgtttagcctcctggctctttgcggagaccgtctggcctcactgcggcgtcaactc
gctctcaacatccattacacgaaactgctgaatgatgcattcggaaaagagtctgcatgg
tttaaagaagacgacggctcgtcttcatgcaaggaccatatcagcaacttcagcgacaag
agcaaactggacgagttccagctcagtgccgacgaagttcaactcatcatcaagggttca
tcggacgggcttcggttgcaagataaaatacaagtgggtggtatggaaatggccgaggcg
ctgctttttagaacggagctccgccagaagcaggagcagcttcggtcggggtattacaca
gaagtcgcgtctgggccggagggagacgaggacggtgattctcaggatgaagatcccgga
cgaaggaaagaccacacaccagccatccatgaatgggtaaccaagcttgccgagcgtggt
atgctgaaggagcttcatgaacaggtaaaagcgcgaaacggttcataa

DBGET integrated database retrieval system