KEGG   Sordaria macrospora: SMAC_03556Help
Entry
SMAC_03556        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smp  Sordaria macrospora
Pathway
smp00220  Arginine biosynthesis
smp00330  Arginine and proline metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
smp01230  Biosynthesis of amino acids
Module
smp_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SMAC_03556
   00330 Arginine and proline metabolism
    SMAC_03556
Enzymes [BR:smp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SMAC_03556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 10808834
NCBI-ProteinID: XP_003351252
Position
Unknown
AA seq 364 aa AA seqDB search
MSPSRLDNQAAAYIAAPSSTKAPMVQELPSPIGSNKTFGMSSPIESKFLSHPEDLGIVAV
GFSGGQCKPGVDAAPSALIESGLLTQLREELGYKLHGDDEVHLYTDLVPKEDPPYRNMKN
PRAVSNVTKRIAEQVYSHAKEGRLVLTLGGDHSIAIGTIAGSAKAIRERLGREIAVIWVD
AHADINTPETSGSGNIHGMPVSFVTGLAREEKEDFFGWLKPDNLLSVKKLVYIGLRDVDP
GEKRILRENGIKAFSMHDIDKHGIGRVMEMALGHIGNDTPIHLSFDVDALDPMWAPSTGT
PVRGGLTLREGDFICECVHETGSLVAVDLVEVNPTLAAPNDVGAHETVRAGCSLVRCALG
ESLL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctcccgcctcgataaccaagcagcggcttatatagctgctccctcgtccaca
aaggcgccaatggtccaagaactaccttctcccataggctccaacaagacttttggcatg
tcttccccaatcgaatccaagttcctttcccaccccgaggacctcggcattgtcgccgta
ggcttctccggcggccagtgcaagcctggtgtcgacgcagccccctccgcccttatcgag
tccggcctcctcacccagctccgcgaagagctcggctacaagctgcacggcgatgacgaa
gtgcacctctacacggacctcgtccccaaggaggacccgccctaccgcaacatgaagaac
ccgcgcgccgtctccaacgtgaccaagcgcattgccgagcaggtctactcgcacgccaag
gagggacgtctggtcctcactctcggcggcgaccacagcattgccattggcaccattgcc
ggctcggccaaggccatcagggagcgcctcggacgcgagatcgccgtgatctgggtcgat
gcccacgccgatatcaacacccccgagaccagtggcagcggtaacatccacggcatgccc
gtcagcttcgtcaccggtctggcgcgcgaggagaaggaggacttctttggctggttgaag
cccgataatctcctcagtgtcaagaagctggtctacattggtcttcgcgatgtcgacccc
ggtgagaagcgcatcctgagggagaacggcatcaaggcgttcagcatgcacgacattgac
aagcacggaatcggtcgtgtcatggagatggccctcggccacatcggcaacgataccccc
atccacctttcgttcgacgtcgatgcgctcgatcccatgtgggctccctccacgggcacc
ccggtccgcggcggtctcaccctccgcgagggcgacttcatctgcgagtgcgtgcacgag
acgggcagccttgtcgccgtcgatcttgtcgaggtcaaccctaccttggcggctcccaac
gacgtcggcgcacacgagactgttcgcgctggttgctccttggttagatgcgctctcggc
gaaagccttctatga

DBGET integrated database retrieval system