KEGG   Sordaria macrospora: SMAC_03649Help
Entry
SMAC_03649        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
smp  Sordaria macrospora
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SMAC_03649
Translation factors [BR:smp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SMAC_03649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 725 aa AA seqDB search
MAPSFDHLRDEDLDEDDFDVDEVDISDIREKYEVQLEQGYDAFVVVDGLPEVTEEQKPKL
VKFLLKKLNTVGKTREDLIFMPMGEDGKSMRFAFVEYSSPAEAAAACRQLDLVPLDKKHT
LRVNKLTDVDRYGREGRIDDEYTPPQIEEFQEKEHLRSFMADPSGRGRDQFVMFRGETVG
FSGNNEKDTPENIVDRQHWTETFVQWSPLGTYLTSVHAQGVQLWGGPSWTRQRRFAHPFV
NLVAFSPNEKYLVTWSNRPISIPEEGHPALSLDTPAAATAEGDAPKKAPKFPWPAFKWSA
DDKYVARLNPGQSISVYELPRMNLLDKTAIKIEGVVDFDWAPATVQRDGVKTYEQLFCFW
TPEIGSNPARVGLMSIPSKQVVRSLNLFSVSDAKLHWQSEGAYICVKVDRHSKSKKSQAT
TLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFVIISTTEPVGATAVPPKTSVAFFC
PEKAKGNAVGNFKHLRTLEKKNSNAIYWSPKGRFVVVATVANTQSSDLDFYDLDFEGEKP
ESDKDLTANLQLMNTADHYGVTDVEWDPSGRFVATWASAWKHSMENGYHLYDFKGEQLRE
EAIEKFKQFQWRPRPATLLSKEEQKAIRRNLREYSRIFEQEDAERISSADVAVVEARRHL
LEEWFAWRESIVQEVAEEREIYGLPADPAAELIKAKTSELSTDGEEQVIEEIMEEVLEET
EEIVQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctttcgaccacctccgcgacgaggaccttgatgaggatgatttcgatgtt
gatgaggtcgacatttccgatattcgcgagaagtacgaagttcagcttgagcagggctac
gatgccttcgtcgttgtcgacggcctccccgaggtcaccgaggagcaaaaacccaagctc
gtcaagttcttgttgaagaagctcaacactgttggcaagacccgggaggacctcatcttc
atgcccatgggcgaggatggaaagtccatgagattcgccttcgtcgagtattcgtcaccc
gccgaggctgctgccgcctgcagacagctcgacctcgtccccctcgacaagaagcacacc
cttcgcgtcaacaagcttaccgatgtcgaccgttatggtcgcgagggccgtatcgatgac
gagtacactcctccccagatcgaggagttccaggagaaggagcacctccgctccttcatg
gccgaccccagcggccgcggcagagatcagttcgttatgttcaggggagagactgttggc
ttttctgggaacaacgagaaggatacccccgagaacattgtcgaccgtcaacactggacc
gagaccttcgtgcagtggtcgcccctcggtacctacctcacctccgttcacgcccagggt
gttcagctttggggtggtccctcgtggaccaggcagaggcgtttcgcccatcctttcgtc
aaccttgtcgccttctctcccaacgaaaagtaccttgtcacctggtccaacaggccgatt
tcgatccccgaggagggtcaccctgctctttcgctcgacacccccgccgccgccaccgcc
gagggcgatgctcccaagaaggcccccaagttcccctggcccgcgttcaagtggtctgcc
gatgacaagtacgtcgccaggctcaaccccggccagtccatttccgtctacgagctcccg
aggatgaacctgttggacaagaccgccatcaagatcgagggcgttgtggacttcgactgg
gcccccgccaccgtgcagcgcgatggtgtcaagacctacgagcagcttttctgcttctgg
acccccgagattggcagcaaccccgccagagtcggtttgatgagcatcccctccaagcag
gttgtcaggtcactgaacctcttcagcgtctcggatgccaagcttcactggcagtccgag
ggtgcttacatctgcgtcaaggttgaccgtcactccaagtccaagaagtctcaggccacc
actcttgagattttccgtgtcaaggagaagggtgttcccgtggaagttgtcgacaccatc
aaggataccgtaataaactttgcctgggagcccaagggcgacaggttcgttatcatcagc
accaccgagcctgtcggtgccaccgccgtcccccccaagacgtcggtcgctttcttctgc
cctgagaaggccaagggcaatgctgttggaaacttcaagcatctccgcactctcgagaag
aagaacagcaacgccatctactggtcgcctaagggtcgcttcgtggtcgttgccactgtt
gccaacactcagagctccgatctcgacttctacgacctcgacttcgagggtgagaagccc
gaatccgacaaggatctcaccgccaaccttcagcttatgaacaccgctgaccactacggt
gtcactgacgtcgagtgggacccctcgggtcgcttcgttgccacctgggcttccgcgtgg
aagcactctatggagaatggatatcatctgtatgacttcaagggtgagcagctgcgcgag
gaggctatcgagaagttcaagcagttccagtggaggccgcgccccgctaccctccttagc
aaggaggagcagaaggccatccgccgcaacctccgcgagtactcgaggatcttcgagcag
gaagacgccgagcgcatcagcagcgccgacgttgccgttgtcgaggcccgccgtcatctc
ctcgaggagtggttcgcttggcgcgagtctatcgtgcaggaggttgccgaggagcgcgag
atctacggtcttcccgcggaccctgctgccgagctcatcaaggccaagacctcggagctc
tccaccgacggagaggagcaggtcatcgaggagatcatggaggaggtgttggaggagacc
gaggagatcgttcagtaa

DBGET integrated database retrieval system