KEGG   Sordaria macrospora: SMAC_03836Help
Entry
SMAC_03836        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smp  Sordaria macrospora
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:smp00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1034 aa AA seqDB search
MDTDLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRELIADHHLGSILLTAKNLKSAEQTAQ
LVQKLQTIAHSSGHPYPLLIALDQENGGVNSLFDESLICQFPSSMGQAAASSPSFSSSPS
GNSSGNSDHLNLAYQIAQATATEVSACGVNLILGPVLDVLTNARYQPLGVRATSDDPQEV
SQYGIAALQGYKDAGVATCGKHFPSYGNLDFLGSNLDIPIITQTLEELSLSALVPFRNAI
ATGKLDAMFVGGCGIANPSMKVAHACLSEQVVDELLREELGFTDGVAISECLEMEALQTE
MGVRTGTIMAVQAGCDLVLLCRAYDVQLEAISGLKLGLENEVLTRERIYTSLKRVLKMKR
GCTDWNKALNPPGVELLKKIHPSHLALSMKAYDDSITVMRDNEKLLPLNQSMHQEEELLL
LTPLVKPLPASAMTKTILEGSSTRIKSENPMHDKWIHRERSAIMSGEGVFRELGRSLARA
RHGKLLHTSYTANGVRPVHESLIQRASTIILLTADANRNLYQAGFTKHVAMMCSLLKASG
HKKNLIVVAVSSPYDFAMDKSIGTYICTFDFTETAMSALVRALFGAFTPRGTLPGTLRKA
PRKAVQNSAGGKAKTRTQHWLVESYDVERDNKGLKDLLFAMARASAPNHQYFYAFGPQSF
SLSTRQAFIPTGDPEHEMVMEEQHLVVRNSSTGALYGFCSTYYLPTTCTGVIGAIFVDPS
KRNVSIGYSLHRRAVRNLLQKHPDIKQLQLGCCIPGIFPGIPFDHSDTLTSAITPSSTTS
TPSAASSGLKSWFSSTCGWNLSPSSSSASTRNRTRKIFNLILPSLQSWSSPPDLPTTLQR
AGVSFDLIYGRTPSTPTPTAEQESALSFVSSHSSPEILHLYRLALFSSNPTYTWIIRAKI
QSPVIERGEQLVGTIVISSDLGREYPSLPSSASSGGAEFTGGIIAPVVSSSSMTGQQANL
VLQGLVMLGLRQNKRDKMACCLLSWVSNSYSGDGDVGLGLGLGNNMDTLLGMGFEVQQVW
EQVTNGVEQFASLG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atggataccgatctggacccactatggcaggacttagactgggccataggccaaatgtta
atcatgggatgggacggcaccgaagtgactccccaaatccgtgaactcatagccgaccac
catctaggctccatcctactcacagctaagaacctgaaatccgccgaacaaacagcccag
ctcgtccaaaagctccaaaccatcgcccactcatccggccacccataccctctcctcata
gccctagatcaagaaaacggcggcgtcaacagtttattcgacgagtccctaatctgccaa
tttccctcatcaatggggcaagccgccgcctccagcccttccttctcctcctccccctcc
ggtaattcctcgggtaactccgaccacctaaacctagcctaccaaatcgcccaagccacc
gccaccgaagtatctgcctgcggtgtaaacctcatcctcggccccgtcctcgacgtgctc
accaacgcgcgctaccaacccctgggtgtacgcgcaacctccgacgacccgcaagaagtt
tcccaatacggcatcgccgccctgcagggctacaaagacgccggcgtcgccacctgcggt
aaacatttcccttcctacggcaacctcgatttcctgggttcgaatctggatatacccatt
atcacgcagacgctggaggaattgtcgctatcggcgctggttccgtttagaaacgcgatt
gctacaggaaaactagatgccatgtttgtaggcgggtgcgggatcgcgaatccgagtatg
aaagttgcgcatgcgtgtttgagcgagcaagtggttgatgagcttttgagggaggaattg
gggtttacggacggggtggcaatttcggagtgtttggagatggaggcgctgcagacggag
atgggcgtgcggacgggcacgatcatggctgtgcaggctgggtgtgatttggtgttgttg
tgtagggcgtatgatgtgcagcttgaggcgatttctggactcaagctggggctggagaat
gaggttttgacgagggagaggatttataccagcttgaagagggtgttgaagatgaagcgc
ggatgcacggattggaacaaggcgttgaacccacccggggttgagctgttgaagaagatc
catccgagtcatttggccttgtcgatgaaggcgtatgatgactcgattacggtcatgagg
gacaatgagaagctgttgccgctgaatcagagcatgcatcaggaggaggagctgttgttg
ctgacgccgctcgttaaaccgttgccggcgagcgcaatgaccaagactattcttgaggga
agctcgaccaggatcaagtcggagaatccgatgcatgataaatggatacatagggaaagg
agtgccatcatgagtggtgagggggtgtttagggaacttgggaggtctctggcgagggct
agacacgggaagttgcttcatacttcgtataccgcgaacggcgtgcggccagtccacgaa
tccctcatccaacgcgcctcaaccatcatcctcctcaccgccgacgccaacaggaacctt
taccaagccggcttcaccaagcacgtagcaatgatgtgttccctcctcaaagcctccgga
cacaagaagaacctcatcgtcgtagccgtctcctccccctacgatttcgccatggacaag
tccatcgggacctacatctgcacattcgacttcaccgagaccgccatgtcggctttagtc
cgcgccctattcggcgcttttacgccccgcggcactttacccggtaccctccgcaaagca
ccacgtaaggccgtgcagaactcagcaggcggcaaagcaaagacgcgaacgcagcactgg
ctcgtcgagtcctacgatgtggagagagacaataagggactgaaagatctgctgttcgcc
atggccagggccagcgctcccaatcatcagtacttctacgccttcggcccgcaatcgttc
tcgctgtccaccagacaagctttcattccgaccggggacccggagcacgagatggtgatg
gaagaacagcacttggtagtccgcaactcctccactggcgctttgtacgggttttgctcc
acttactacctccccaccacttgcacgggcgtcataggcgccatcttcgtcgacccgtcc
aagcgcaacgtttccatcgggtactccctccaccgccgggccgtgagaaatctcctccag
aaacacccagatatcaaacaacttcagctgggttgctgcatcccggggatcttccctggt
atcccatttgatcattccgataccctcacctcagctataacacccagctctacaacatcc
accccttcagccgcctcatcgggtctcaaatcctggttctcttccacctgcggctggaat
ttatccccttcatcttcttcagcgtcgacccgcaaccgcacccgcaaaatctttaacctc
atcctcccctccctccaaagctggtcctcacccccggacctgcccaccaccctccagcgc
gctggtgtatccttcgacctcatctatggccgcaccccaagtaccccaaccccgacagca
gagcaagaatccgccctgtccttcgtctcgtcccactcctcgcctgagatcctccacctc
taccgcctcgctctgttttcttccaatcccacgtacacgtggatcattcgcgccaagatc
caatcaccggtgatagaaagaggagagcaactggtaggcaccatagtaatcagcagtgat
ttgggaagggaatacccttcactcccgtcgtccgcatctagtggcggggcggagttcacg
ggagggattattgcgcctgttgtgtcatcatcatctatgacaggacagcaagccaacttg
gtgttgcagggcttggtgatgttggggttgagacaaaataagagggataagatggcttgt
tgtttgttgagctgggtgagtaatagttactcaggggatggagatgtggggctggggctg
ggactgggaaataacatggacacgttgttgggcatgggatttgaggtccagcaggtttgg
gaacaagttacaaatggtgttgagcagtttgcttcgcttggttga

DBGET integrated database retrieval system