KEGG   Sordaria macrospora: SMAC_03929Help
Entry
SMAC_03929        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SMAC_03929
Transfer RNA biogenesis [BR:smp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SMAC_03929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 571 aa AA seqDB search
MATTTVTVSRSKKDANLPSENDRFLRCCADIANALIEDHEAAQNGRPQKDINLNSLRSKF
AKKHKINNVPPLTAIIAAVPEHYKKYILPRLIAKPIRTSSGIAVVAVMCKPHRCPHIAYT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKSLGHSVDKV
EYIIMGGTFMSLPESYRDEFISQLHNALSGYGTLNVDEAVRSGEQSNIKCVGITIETRPD
YCLQPHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHM
MPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNGL
IDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTRE
VGVNEVKNKIRPNQIELVRRDYTANGGWETFLAYEDPKQDILVGLLRLRKCSEKYTFREE
LVGQPTSLVRELHVYGMAVPLHVRDPRKFQHQGFGTLLMEEAERIARDEHGSVKISVISG
VGVRSYYRKLGYWLDGPYMSKWLDGRPGPEE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaacaacggtcacagtaagtcgcagtaagaaggacgccaacttgccgtccgaa
aacgacaggtttctgaggtgttgcgccgacatcgcgaacgcgctcatcgaagaccatgaa
gccgcccagaacggccgtccgcaaaaggacatcaacctcaacagcctgcgatccaagttt
gcgaagaagcacaagatcaacaatgtcccgccactgaccgccatcatcgccgccgtcccc
gaacattacaagaagtacatcttgcccagactcatcgccaagcccatcagaacctcatcg
ggcatcgctgtagtggctgtcatgtgcaagccccatcgatgcccccatatcgcgtatacc
ggaaacatttgcgtctactgccccggtggcccagactccgatttcgagtacagcacacag
tcatacacgggatatgagccgacatcgatgagagccatccgggctcgctacgaccccttc
gagcaggcgagaggacgagttgatcagctaaagtcgttgggtcactcggtagacaaggtc
gaatacatcatcatgggcggcacttttatgtcgctccccgaatcatacagagacgagttc
atttctcaactacacaacgccctgagcggttatggaaccttgaacgtggacgaggcggta
aggtcgggagagcagagcaacatcaagtgcgtgggtatcacgatagagacgagaccagat
tactgtcttcagccccatctttcaagcatgctgcgctacggctgcacccgtctcgaaatc
ggcgtccagtccctctacgaagacgtcgcccgcgataccaaccgtggccacaccgttgct
gccgtcgctgagaccttctgcctcgccaaggatgccggtttcaaggtggtcagtcacatg
atgcccgatcttcccaacgttggtatggagagagatctcgaccagttccgggagtacttt
gaaaacccagctttccgcaccgatggcctgaagatttatcccacccttgtcatccgtgga
acgggcctgtacgaattgtggaggacaggcaggtatcagaactacacgcccaacggcttg
atcgacctcgtggcaaggataatggccctcgttcctccttggacccgtatctaccgcgtc
cagcgtgatattcccatgccgttggtaacatccggcgtcgagaacggtaatctgcgcgag
ctggctctggcgcgtatgaaggactttggaaccacctgccgcgatgtacgcactcgtgag
gttggtgtgaacgaggtcaagaacaagatcaggccgaaccagattgagcttgtccgtcgc
gactacaccgccaacggtggctgggagacgttcctggcctacgaggatcccaagcaggat
atcttggtcggtctgctccgtctgcgcaagtgctccgagaagtacacgttccgtgaggag
ctggttggccagcccaccagtctggtccgcgagctgcacgtttacggtatggctgtgcct
ttgcacgtcagagaccccaggaagttccagcatcagggttttggtacgctcctcatggag
gaggccgagaggatcgcgagggacgagcatggaagcgtgaagatcagcgttatctctggt
gtcggtgtgcgcagctactacaggaagctcggatactggctcgatgggccttacatgtcc
aagtggctcgatggcaggcccgggcctgaggagtag

DBGET integrated database retrieval system