KEGG   Sordaria macrospora: SMAC_03962Help
Entry
SMAC_03962        CDS       T01610                                 

Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
smp  Sordaria macrospora
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SMAC_03962
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SMAC_03962
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SMAC_03962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1151 aa AA seqDB search
MFSATEALLVSHNSPSTLPQAISQAMASNTSPPRRARPAQVHTTLTLQPHVPTSIPPLSA
TSTSSASPTSQQPSPALTPDTAVAIFTESSSLQDSPATFASSTQKETDSYASTTKGMEDP
VTPLNLPEPLAPAPLSSKTSSTSLKKNGEKVGEKIPRQQNAMGEALAKSSFAGSLVRRAS
NTVNKARDILTRRASMNTINRDADPMVASFRRGSNTFPLGEPNYRGYLLESDDECAIDDA
SPFDGLRDAQIPLSIGPEIPVALRQGVILKKISKKKKEKRITLTIDPDTSKIWWDKSRSG
RKSVFIDDIKEVRTAEDIRQYRLDAGVDESEEPRFFSILYTVPEKSGTKVLHLIALNSTD
FRNWVTTLNAILQYRQDFTTNLMASNEKAVHEFWQRQMRKKYADRNTPAEGETIELPDIE
RICRSLHMHLSPTEIRDNFNAAKAAKAASNGPCDPTSPSNLNFNEFKEFVRLLKARTEIT
VVFETHTANPKAGMTRQEFMHFLKETQCENVEEDLTHWNDIFSQFARKRRSKDAEQTTSE
DESLVISEAGFTGFLTSRFNNLLVQEPSEYVLDRPMNEYYISSSHNTYLLGRQVRGISSV
EGYISALERGCRCVEVDCWDGPNDEPYVSHGHTWTTRIKFEEVIKTINKYAFVKSRFPLW
ISLEVRCSTATQANMAKIMIDIFGDKLVRAPLDPSSDRLPSPSELIERILIKVKKSQPVP
SAPSEESLKTERPGRRRGNSLPSPYQRSSPLSSPMDNTPIAVPGSPSLSPSPLSRSTRQI
NTITEGEVHSHGGPSSSPSEYESDAEKESGKKVVSKINPVLGELGVYCMGVHFDGFDSPD
AKRFNHIFSFKEKTFAERSQPGEAKRALYRHNMRYLMRVYPNGGRISSSNFDPLLYWKRG
VQMAALNWQTFDLGMQLNQAMFDSGTDLSGYVLKPLEGRQIQVVPTDAAGQLLGKRPRKK
ISFKIEVISAQQLMRPLNHPKGRTLDPYVEVEIFLADDKRNKQDGATNAPAQETLLKYRT
DIVKDNGFNPVFKGNNSYEFTVTTKYPDLIFVRWSVKLGDHKGYNDRSPPLATFTAKLGG
LKQGYRTIPLLDHNGYNYLFSTLFCKITKSQPTDIMVAYSSEVPRNSVSRIKNIFNQSGI
SPKSSMDSGRT
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagccacagaggctctcttagtctctcacaactccccctcgactttgccccag
gccatatcccaagccatggcttcaaatacctcaccaccacggcgggcacgtcctgcccag
gttcacacaactctcacgctacagccccatgttcccaccagcattcctccgttgtccgcc
acgagcacgtcatctgcctcccctacttcacaacaaccctctccggccttgacaccggac
acagccgtcgccatcttcacagaaagcagctccctgcaggattcacccgcaaccttcgcc
tcatctacgcaaaaggaaacggactcttacgcttctacgaccaagggaatggaggaccca
gttacacctctcaacctccccgagccacttgccccggctcctttgtcatcaaagacaagc
agcacctcgctaaaaaagaatggagagaaagtcggagagaagatcccacgacaacagaat
gctatgggcgaggctctggccaaaagcagctttgcgggcagtctggtccgtcgtgcttca
aatactgtgaacaaagcgcgcgacatacttacacgaagagcgtcgatgaataccatcaat
cgggatgctgaccctatggtggcgtctttccgccgtgggagtaacaccttcccactcggg
gaaccgaactacagaggttacttgctggaatcagatgacgagtgtgctatagatgatgcg
agtccgtttgatgggttgcgagacgcccaaattcccctgagcattgggcctgagattccg
gtcgctttacgccaaggtgtcatattgaagaaaatcagcaagaagaaaaaggaaaagaga
atcaccctcaccattgatccagacacttccaagatatggtgggacaagagtcgatcaggg
agaaagtccgtttttatcgatgacatcaaggaagtaaggacggcagaggacattcgacag
taccgccttgacgccggggttgatgagtccgaagagccccggtttttctcaatcctgtat
acagtcccagaaaagtcggggaccaaggtattgcatctcattgccctgaattccaccgac
ttccggaactgggtcacgacactcaacgccatacttcagtatcgccaagacttcacgacg
aacctgatggcctccaacgaaaaggctgtccacgagttctggcagcgacaaatgagaaag
aagtacgcagacaggaacactccggccgaaggcgaaaccattgaacttcccgacattgag
cgaatctgtcgctctctccacatgcacctctcgccaacagagatccgcgacaacttcaac
gcggctaaagctgccaaggctgcgtccaatggcccctgtgatccaacctctccttccaat
ctgaacttcaatgagttcaaggagtttgtgcggctactgaaggcaaggacagagataacc
gttgtcttcgaaacccatacggccaaccctaaagcagggatgacgaggcaagagttcatg
catttcttgaaagaaactcaatgcgaaaacgtggaggaagatcttacgcattggaacgat
atcttctctcagttcgcgcgtaagcgcaggtccaaggatgctgagcagaccaccagcgag
gacgagtcactggtcatctctgaggctggcttcactggatttctgacttcgcggttcaac
aacttgctcgttcaagagccatctgaatatgtactcgaccgacctatgaatgagtattat
atctcaagctcacacaacacatatctccttggtcgccaagtccgtggaatctctagcgtc
gaaggctatatttcggcccttgagcgtggttgcaggtgcgttgaagttgactgctgggac
ggcccaaatgacgagccgtatgtgtcacacggtcatacttggacaacacgcatcaaattt
gaggaggtgatcaagaccatcaacaagtatgcctttgtcaagtctcgcttccctctctgg
atatcgctggaggtccgctgcagcactgctactcaggccaatatggcaaagatcatgatt
gacatttttggcgacaagcttgtccgggcgcccctcgatccgtcctctgatcgactccct
tcaccgtccgagttaatcgagcgcatacttatcaaggtcaagaagtcccaaccagtaccc
agcgcaccatctgaggagtcgctgaagactgagcgacctggtcggaggcgcggcaacagc
ctgccctcaccttatcagaggtcatcacctttgtcatcgcctatggataacacacccatc
gccgtccctggaagcccttcgttgagtccaagtccattgtcccgctcgacacggcagatc
aacaccatcactgagggcgaggttcattctcacggggggcctagtagcagccctagcgaa
tacgagagtgatgctgagaaggagtcggggaagaaggtggtgagcaagatcaaccctgtc
cttggcgaactgggcgtatattgcatgggtgttcactttgatgggttcgacagccctgac
gccaaaaggttcaaccacatcttctccttcaaagaaaagacctttgctgagagaagccaa
ccgggcgaagcaaagcgtgctttgtaccgtcataacatgcgctatctcatgcgggtgtat
ccgaacggaggtcgtatatcttctagcaactttgacccactcctctattggaagcgcggg
gttcaaatggcggcacttaactggcagaccttcgacctgggaatgcagctgaatcaggcc
atgttcgatagtggcaccgacttgtccggctacgttctcaagccccttgaaggacgtcag
atccaggtcgtcccaacggatgctgccgggcagctgttgggtaagagaccgcgcaaaaag
atctcgttcaagattgaggtcatctctgcgcaacagttgatgaggccactgaatcatccc
aaggggcgaacactcgatccgtatgtcgaagtcgagatcttcctggccgatgacaagaga
aataagcaagatggtgccacaaatgcgccagctcaggaaactctgctgaaatatcgcacc
gacatcgtcaaagataatggcttcaaccccgttttcaaaggcaataactcttatgagttt
actgttaccaccaagtaccctgatctcatatttgtgcgctggagcgtgaagcttggcgac
cacaaaggatacaacgaccgcagccctcctctggcgactttcacagccaaacttggcggc
ctcaagcaaggttaccgcacgataccgctgcttgatcacaatgggtacaattacctgttc
tcgaccctcttctgcaaaatcaccaagagccaacctaccgatatcatggttgcctattcc
agcgaagttccgagaaacagtgttagcagaatcaagaacatcttcaaccagtccggcatc
agccccaaatccagcatggatagcggccggacctga

DBGET integrated database retrieval system