KEGG   Sordaria macrospora: SMAC_04037Help
Entry
SMAC_04037        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
smp  Sordaria macrospora
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 393 aa AA seqDB search
MLRPSCIASCLAALAAAHGDHSQKVVAGPHQGLWYNHLPGDGGTQADSVFSGISTFGRLP
YLPCLASKDINYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGGYNVPLATNPF
NSWATVIDCGDIPVTSYDNTFALSQIEQGHHSILSRAPATDAHKPGPSLHGETLPRVITL
GGDHTITLPLLRSINRAYGPVSVIHFDSHLDTWRPKVFGGSPSEVASVNHGTYFWHAAQE
GLLRNDSNIHAGIRTTLSGPSDYENDGYCGFEIVEAREIDTIGTEGIIKKIRERVGTERP
VYLSLDIDTLDPAFAPATGTPETGGWSTRELRTILRGLEGINIIAADIVEVAPAYDTNAE
HTTMAAADALYEIMSIMVKRGPLSVTSAPPRDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcccaagctgcattgcctcttgtctcgctgctctggcggcagcacatggcgac
catagtcaaaaggtcgtggcaggccctcatcaaggcttgtggtacaatcacttgcccggg
gatggaggcactcaggctgattctgtcttctccggcatctcgacctttggccgtctaccg
tacctaccatgtcttgccagcaaagatatcaactacgatattgcctttattggcgcccca
tttgacaccggcacttcatatagacccggcgctcgcttcggtccatcaggaatccgtcaa
ggatctcgtcgtttgaacctatacggcggctacaacgtcccgctagccaccaaccccttc
aacagctgggccaccgtgatcgactgcggcgacatccccgtgacctcgtacgacaacacc
tttgcgctctcgcagatcgagcaaggtcaccactccatcctctcccgcgcccccgccacc
gacgcccacaagcccggcccttccctccacggcgagaccctcccccgcgtcatcaccctc
ggaggcgaccacaccatcaccctcccgcttctgcggagcatcaatcgcgcctacggcccc
gtgtccgtcatccacttcgacagccacctcgacacgtggcggcccaaagtctttggcggg
tccccctcggaggtcgcgtccgtcaaccacgggacgtatttctggcatgccgcgcaggag
ggactgctgaggaacgatagtaatatccatgcggggatacgcacgacgctgagtggcccg
tcggattacgagaatgatgggtattgcgggtttgagattgtcgaggctagggagattgat
accattgggacggaagggattattaagaagattcgggagagggtgggtaccgaacggccg
gtttatttgagtttggatattgatactttagatcctgcttttgccccagccaccggcacc
cccgagacaggcggatggtctaccagagagcttaggaccattctaagagggttggaagga
atcaatatcattgctgctgatattgttgaggttgcgcctgcctatgataccaacgctgag
cacacgaccatggcggctgccgatgccttgtacgagatcatgagcatcatggttaagcga
ggaccgcttagcgtaaccagtgcgccgccgcgcgatctctag

DBGET integrated database retrieval system