KEGG   Sordaria macrospora: SMAC_04037Help
Entry
SMAC_04037        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
smp  Sordaria macrospora
Pathway
smp00330  Arginine and proline metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMAC_04037
Enzymes [BR:smp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SMAC_04037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 10805639
NCBI-ProteinID: XP_003348192
UniProt: F7W0N4
Position
Unknown
AA seq 393 aa AA seqDB search
MLRPSCIASCLAALAAAHGDHSQKVVAGPHQGLWYNHLPGDGGTQADSVFSGISTFGRLP
YLPCLASKDINYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGGYNVPLATNPF
NSWATVIDCGDIPVTSYDNTFALSQIEQGHHSILSRAPATDAHKPGPSLHGETLPRVITL
GGDHTITLPLLRSINRAYGPVSVIHFDSHLDTWRPKVFGGSPSEVASVNHGTYFWHAAQE
GLLRNDSNIHAGIRTTLSGPSDYENDGYCGFEIVEAREIDTIGTEGIIKKIRERVGTERP
VYLSLDIDTLDPAFAPATGTPETGGWSTRELRTILRGLEGINIIAADIVEVAPAYDTNAE
HTTMAAADALYEIMSIMVKRGPLSVTSAPPRDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcccaagctgcattgcctcttgtctcgctgctctggcggcagcacatggcgac
catagtcaaaaggtcgtggcaggccctcatcaaggcttgtggtacaatcacttgcccggg
gatggaggcactcaggctgattctgtcttctccggcatctcgacctttggccgtctaccg
tacctaccatgtcttgccagcaaagatatcaactacgatattgcctttattggcgcccca
tttgacaccggcacttcatatagacccggcgctcgcttcggtccatcaggaatccgtcaa
ggatctcgtcgtttgaacctatacggcggctacaacgtcccgctagccaccaaccccttc
aacagctgggccaccgtgatcgactgcggcgacatccccgtgacctcgtacgacaacacc
tttgcgctctcgcagatcgagcaaggtcaccactccatcctctcccgcgcccccgccacc
gacgcccacaagcccggcccttccctccacggcgagaccctcccccgcgtcatcaccctc
ggaggcgaccacaccatcaccctcccgcttctgcggagcatcaatcgcgcctacggcccc
gtgtccgtcatccacttcgacagccacctcgacacgtggcggcccaaagtctttggcggg
tccccctcggaggtcgcgtccgtcaaccacgggacgtatttctggcatgccgcgcaggag
ggactgctgaggaacgatagtaatatccatgcggggatacgcacgacgctgagtggcccg
tcggattacgagaatgatgggtattgcgggtttgagattgtcgaggctagggagattgat
accattgggacggaagggattattaagaagattcgggagagggtgggtaccgaacggccg
gtttatttgagtttggatattgatactttagatcctgcttttgccccagccaccggcacc
cccgagacaggcggatggtctaccagagagcttaggaccattctaagagggttggaagga
atcaatatcattgctgctgatattgttgaggttgcgcctgcctatgataccaacgctgag
cacacgaccatggcggctgccgatgccttgtacgagatcatgagcatcatggttaagcga
ggaccgcttagcgtaaccagtgcgccgccgcgcgatctctag

DBGET integrated database retrieval system