KEGG   Sordaria macrospora: SMAC_04163Help
Entry
SMAC_04163        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smp  Sordaria macrospora
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMAC_04163
Enzymes [BR:smp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SMAC_04163
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMAC_04163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 706 aa AA seqDB search
MNDISDNSSNSLANGGGTVANTSIPKDGTGVLSIDPWLEPFQDALKRRYSKAQSWIDTIN
KTEGGLEKFSRGTELFGLNVNKDSSITYREWAPNAKQASLIGEFNNWDRNAHRMKKNEYG
VFEITIPPTAPGTPAIPHHSKIKITLELPDGQWVDRLPAWIKYVTQDLSVSPAYEARFWN
PPQAERYTFKHKRPSKPQSLRIYEAHVGISSPECKVATYKEFTKNMLPRIKNLGYNAIQL
MAIMEHAYYASFGYQVNSFFAASSRYGPPEDLKELVDTAHALGIVVLLDVVHSHASKNVL
DGLNEFDGTDHQYFHGGAKGKHELWDSRLFNYGHHEVMRFLLSNLRFWMDEYAFDGFRFD
GVTSMLYTHHGIGTGFSGGYHEYYGPDVDEEAVVYLMVANEMLHGLYPEVITVAEDVSGM
PALCLPLSLGGVGFDYRLAMAIPDMWIKILKEKKDEEWDIGAITWTLTNRRHGEKTIAYA
ESHDQALVGDKTLMMHLCDAELYTNMSVLTPLTPVIDRGMALHKLIRLLTHSLGGEGYLN
FEGNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDGLLRYQFLNNFDRSMNLCENKYGWL
HAPQAYISLKHEGDKVIVFERAGLVFIFNFHHTNSYTDYRIGIEQAGTYRIVLDSDTQDH
GGFNRLDPQTRFFTSDLPWNNRKNSTHVYIPTRTAIVLALESTLSE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatctcagacaactcctccaactcgctggctaacggcggcggcaccgttgcc
aacaccagcattcccaaggatggcaccggtgtcttgagcattgacccctggctcgagccg
ttccaggatgctctcaagagacgctattccaaggcccagtcttggatcgataccatcaac
aagacagaaggtggtttggagaagttcagcaggggtaccgagctctttggtttgaacgtc
aacaaggacagcagcatcacatacagagaatgggctcccaacgccaaacaagcatccctt
attggcgaattcaacaactgggataggaacgctcaccgcatgaagaagaacgagtacggc
gtcttcgagatcacaattcctcccactgcccccgggacaccagctatcccccaccactcc
aagatcaagatcaccctcgaactccccgacggccaatgggtcgacagactgccggcatgg
atcaaatatgtcacccaggacctctcagtctcgcccgcatacgaggcgaggttctggaac
cctccccaggccgaaagatacacattcaagcacaagcggccctcgaagccccagagcctt
aggatctacgaggcccacgtcggcatttcctccccggagtgcaaggtggctacttataag
gagttcacaaagaacatgcttccccgcatcaagaacctgggatacaacgccattcagctc
atggccatcatggagcacgcctactatgccagtttcggttatcaggtgaacagcttcttc
gctgccagcagcagatacggcccgcccgaggatctcaaggagttggtggatactgcccac
gccttgggcattgttgtgctgctcgacgtcgtccacagtcacgcctccaagaacgtcctt
gatggcttgaatgagtttgacggtaccgatcaccagtacttccatggtggcgccaagggc
aagcacgagctctgggacagcaggcttttcaactacggtcatcacgaggttatgaggttc
ttgctcagcaacctgaggttctggatggacgagtacgcctttgatggcttcagattcgat
ggtgtgacgagcatgctctacacccatcacggtatcggaaccggtttctccggtggctac
cacgagtactacggccctgacgttgatgaggaagcggttgtttaccttatggtcgccaac
gagatgctccacggactataccccgaggtcatcaccgttgccgaggatgtatcaggaatg
ccggctctgtgcctgccactttccctaggaggtgttggcttcgactacagactcgccatg
gccattcccgacatgtggatcaagatcttgaaggagaagaaggacgaggagtgggacatt
ggtgccatcacctggaccctgacaaaccggcgtcacggcgagaagaccattgcttatgct
gagagtcacgatcaagcactcgtcggtgacaagaccctcatgatgcatctctgcgatgcc
gagttgtacaccaacatgtctgtcctcacgcctctgaccccggtcattgaccgcggcatg
gccctgcacaagttgatccgtctccttacccactccctgggaggtgagggttacctcaac
ttcgagggcaatgagttcggccaccctgagtggcttgacttcccccgtgagggcaaccag
aactcgttctggtacgccaggcgtcagctcaaccttacggaagatggtcttttgcgttac
cagttcctcaacaactttgacaggtcgatgaacctgtgcgagaacaagtacggctggttg
cacgcccctcaggcctacatctctctcaagcacgagggtgacaaggtcatcgtctttgag
cgcgccggcttggtcttcatcttcaacttccaccacaccaacagctacaccgattaccgc
atcggcatcgagcaggcgggcacctaccgcatcgttctcgactcggatacccaggatcac
ggtggcttcaaccgtctcgatccccagactcgcttcttcacttccgacctcccgtggaac
aaccgcaagaacagcacccatgtgtacatcccgaccaggacagccattgtccttgcgctc
gagtccaccctttcagagtag

DBGET integrated database retrieval system