KEGG   Sordaria macrospora: SMAC_04573Help
Entry
SMAC_04573        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SMAC_04573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MEFGDARDARSLPRMAASRTATRTLRALRTSTLPALTATPRAAFRQGGRRLYSSEPAKSG
GSNIWAWAIGAGALGAGGLWYLNQDGASATPKVITPKFEDYQAVYNEIASRLEEKDDYDD
GSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKF
PWITYSDLWILAGVCAIQEMQGPKIPYRPGRQDRDVAACTPDGRLPDASQAQDHLRNIFY
RMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVMTNDYYKLLLDEKWQWKKWNGP
KQYEDKKTKSLMMLPADMALIQDKTFKQWVQKYAANNELFFQDFSNVIVKLFELGVPFAE
NSERWVFKPVNA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagttcggcgatgcccgtgatgcgcgatctcttcctcgcatggccgcctcccgcact
gccacccgcactctccgcgctctgcgcacctcgactctccctgcgctcactgccacgccc
cgcgctgctttccgccagggtggtcgtcgcctctactcttctgagcccgccaagtccggt
ggctccaacatttgggcctgggctatcggtgctggtgctctcggtgccggtggtctctgg
tatctcaaccaggacggcgcttccgccactcccaaggttatcactcccaagttcgaggac
taccaggccgtctacaacgagattgcctcccgcctcgaggagaaggacgactacgacgat
ggcagctacggccccgtcctcgtccgtctcgcctggcacgccagcggcacctatgacaag
gagaccggcactggtggctccaacggtgccaccatgcgcttcgctcccgagtctgaccac
ggtgccaacgccggcctgaaggctgctcgtgacttcctcgagcccgtcaaggccaagttc
ccttggatcacctactccgacctctggatccttgccggtgtctgcgccatccaggagatg
cagggccccaagatcccctaccgccccggtcgccaggaccgtgatgtcgctgcctgcact
cccgacggccgtcttcctgatgcctcccaggcccaggaccatctccgcaacatcttctac
cgcatgggcttcaacgatcaggagatcgttgctcttgccggtgctcacgctctcggccgc
tgtcacaccgaccgctccggcttcgacggcccctggaccttctcccctaccgtcatgacc
aacgactactacaagctccttctcgacgagaagtggcagtggaagaagtggaacggcccc
aagcagtatgaggacaagaagaccaagtccctcatgatgcttcccgccgacatggccctc
atccaggacaagactttcaagcaatgggttcagaagtacgccgccaacaacgagctcttc
ttccaggacttctccaacgtcattgtcaagctcttcgagctcggcgttcccttcgccgag
aactccgagcgctgggtcttcaagcccgtcaacgcctaa

DBGET integrated database retrieval system