KEGG   Sordaria macrospora: SMAC_04644Help
Entry
SMAC_04644        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 860 aa AA seqDB search
MAGFFNKLKGAGAGSSKTDNNASSKNKKDEPAVELTPLERILQNAGPLREDGSDKYFGLE
NFGNTCYCNSILQALYYSEPFRENVVNYPPLNNPSEGTTNKVKVSIRPPVQVNGNAATPG
KQFAKPRQGFTPGPIPMPITQPIRPEDRPDAPEYKKKQAMIKGPVLELAQENPDAYGMEE
CTFTGLKDIFTALIQSSSRTGVISPQRFLDIFKRDNEMFRNSMHQDAHEFYGLVLNDVIS
NVEAYARRMQESGKVNGTIQSPLNQLSSSPSLMRSMMASNFRTPETSWVHDIFEGVLVSE
TRCLTCETASQRDETFLDLSIDLEEHSSVTSCLRKFSAEEMLCERNKFHCDHCGGLQEAE
KRMKIKKLPKVLALHLKRFKYTEDYSRLQKLFHRVVYPYYLRMFNTTDDAEDPDRIYELY
AVIVHIGGNAYHGHYVSIIKTKDRGWVLFDDEMVEPVDKNFVANFFGDKPGMACAYVLFY
QEVTFEKMREELDAEGLEEMRLATQAADLAAGVEQVNGTEKNPLMKVNSQPTVPVEDLDP
SVSLAHAQTAPGGIASILQYSTPTQAPGPEPYSHPLAAAPPPAPAVMTKADEAATVPPKS
KEEIAKEKKEQKAQEKAQEKARKAAEKEAARLAEKERLEKLAKKREAQQKEQEQLAKVMR
ESKQLAAEEERRRKKEAAAAEGGTKSGPSSPGLFNRAGLGSKSLSRKSFAFLGKTGGGGS
DKSEKSSDRAGSSSTEHRSNGSMTSSGVAESNASSRATTGDGYGSGGNGFGGFSPSSPLS
PTSRGGPNGIHSHHHHPSSPMRSMTTPEGLKRDVRASRSASTSSIPGPPPTPPESRFEKP
PLRDRFSFSIGRKKSSRFLS
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggcagggttcttcaacaaactgaaaggcgcaggtgcaggaagctccaaaaccgacaac
aatgcctcctccaaaaacaaaaaggacgagccggcggtggaattgactccccttgagagg
atactgcagaatgctgggcctctccgagaagatggaagcgacaagtactttggcttggaa
aattttggcaacacatgctattgtaactcgatccttcaagcgctatactactcggaacct
ttccgagagaacgtcgttaattacccgccgttgaataacccatcagaaggcacgacgaac
aaagtcaaagtctcgatacggcccccggtacaagtcaacggaaatgcggcgacgcctggc
aagcaatttgccaaaccccggcaagggtttactcctggaccgataccgatgccaataacg
caaccgatacgacccgaagacagacctgacgcccccgaatacaagaaaaagcaggctatg
atcaaagggcctgttttggagttggcccaggaaaatccagatgcgtacggcatggaggaa
tgcacctttactgggctgaaggatatttttactgctctgattcagagcagctccaggact
ggcgtcatcagtccacaacgctttctggatattttcaagcgcgataacgaaatgttccgc
aactccatgcaccaagacgcacacgaattctacggccttgtattgaacgacgttatatca
aatgtggaggcatacgctaggcggatgcaggagagcgggaaggtaaacggaacgatacag
tctccattgaaccaactatcctcatccccaagcctcatgaggagcatgatggcatccaat
ttcaggacgcccgagacgagctgggtccacgacatattcgaaggcgtcctagtttctgaa
accaggtgcttgacttgcgagacggcgtcacaacgagacgaaacgtttctggatctctcg
atcgacctggaagaacattcttcagtaacatcatgcctacggaaattttccgcagaggag
atgctttgcgagagaaacaagttccactgcgatcattgtggcggcctgcaagaggctgaa
aagaggatgaagattaagaagctaccaaaggttttggccctgcatctgaagaggttcaag
tataccgaggactacagtcggctccaaaagctctttcatcgagtcgtttatccatattac
cttcgcatgttcaacacgaccgatgacgcggaggacccggacaggatctacgaattatac
gcagttattgttcatattggaggtaatgcctaccacggacactacgtatcaatcatcaag
accaaggaccgaggctgggttttgttcgatgacgagatggtcgagcccgtcgacaagaat
tttgtggccaacttctttggcgacaagccaggcatggcttgcgcctacgtactattttac
caggaagtcaccttcgagaagatgagggaagagttggatgccgaaggactggaagagatg
aggctagccacacaagcagccgacctcgcagccggcgtagaacaggtgaacggaaccgaa
aagaaccccttaatgaaggtcaacagccagccgacagtaccggtcgaggaccttgaccca
tcggtaagcctcgctcacgcccaaacagctccaggcggaattgccagtatcttacaatat
tcgacgccgacccaggcccccggacccgagccttactcccatcctctagctgcggcacca
cctccggcccctgccgtcatgacaaaggcggacgaggcagccacggtcccaccgaaatcc
aaggaagaaattgccaaggagaagaaggaacaaaaggcccaggagaaagcacaggagaag
gctagaaaagccgctgagaaagaggcagcaaggcttgcagaaaaggagcgtctcgaaaag
ctcgccaagaagcgcgaagcacagcagaaagagcaggagcaactagcaaaggtcatgcgc
gaaagtaaacaactggcagccgaagaggagaggaggcgcaagaaggaggcggcagccgct
gaagggggcaccaagagtggccccagcagccccgggttgttcaaccgcgccggcctgggt
agcaagtctctctcacgcaagagctttgccttcctgggaaagactggaggcggtggtagc
gacaagtccgaaaagagcagtgacagggcgggaagcagcagcaccgagcataggagcaat
ggcagcatgaccagcagcggcgtggctgagagcaacgccagtagccgcgcgactactggc
gatggctatggcagcggcggcaatggctttggggggttctctccatcatcaccgttatcg
cccacctcacgaggggggccaaacggtattcactcccaccaccatcatccgagctcgcct
atgagatctatgactacgccagagggtctcaagagagacgtgcgagcttctaggtcggct
tcgacgtcatccatacccggcccaccccctacgcccccggagagcaggttcgagaagccg
ccgctgcgagaccggttcagcttcagcatagggagaaagaagagttcgcggttcctgtca
tag

DBGET integrated database retrieval system