KEGG   Sordaria macrospora: SMAC_04769Help
Entry
SMAC_04769        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SMAC_04769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 10803986
NCBI-ProteinID: XP_024511528
Position
Unknown
AA seq 692 aa AA seqDB search
MAELDTLDLVVLAAILLGTVAYFTKGTLWGVTKDPYASSLANASGAKAGKTRNIVEKMEE
QGKNCIIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEEYDFDNLDTIPDDKVVFFV
LATYGEGEPTDNAVDFYEFITNEDVNFTEGNEPALGNLNYVTFGLGNNTYEHYNSMVRNV
DKALQKLGAHRIGDAGEGDDGAGTMEEDFLAWKEPMWTALAEKMGLEEREAVYEPVFSIV
EREGLTKESPEVYLGEPNKMHLDGTAKGPFNAHNPYIAPIAQSYELFSVKDRNCIHMDID
ISASNLNYQTGDHIAVWPTNPGDEVDLFMNVLGLSDKRHTVVSVKALEATAKVPFPTPTT
YDAIVRYHMEICAPVSRQFLAQLAAFAPDAESKAEMTKLGAEKDYFHEKISVHHLNIARV
LDIVGKGQKWTNIPFSAFIEGITKLQPRYYSISSSSLEQPKKISITAVVESTQLPGRDDP
FRGVATNYLLALKQKQNGDPEPCPFGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSDPSK
PIICIGPGTGVAPMRGFIRERVQQAKNGEKVGKTLLFFGCRKSTEDFMYKDEWEEAKQVL
GDNFELITAFSREGTKKVYVQHRLKERAEEINQLLEQKAYFYVCGDAANMAREVNTVLGN
IISEQRGIPEAKAEEIVKNMRSANQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactcgacacgctggacctcgtggtcctggcggccatccttctcggaacggtc
gcctacttcacaaagggcacactatggggcgttacaaaggatccttatgccagctccctg
gccaacgccagcggcgcaaaggctggcaagacaagaaacatcgtggagaagatggaggag
cagggcaagaactgcatcatcttctatggctcccaaaccggtactgctgaggattacgct
tcgagactcgccaaggagggcaagagccgcttcggtcttgagaccatggttgctgacctt
gaggaatacgactttgacaaccttgatactatccccgacgataaggtggtgttcttcgtg
ctcgccacctatggtgagggcgagcctactgataacgccgtggacttctacgagttcatc
accaacgaggacgtcaacttcaccgagggcaacgaacctgcgcttggcaacctgaactat
gtcaccttcggtctcggaaacaacacctatgagcattacaactccatggttcgcaatgtg
gacaaggcgctccagaagctgggcgcccaccgtatcggtgatgctggcgagggtgatgat
ggcgctggcaccatggaggaagatttcttggcctggaaggaacccatgtggactgctctc
gctgagaagatgggcttggaagagcgcgaggctgtttacgagcccgtcttcagcattgtt
gaaagggagggcctgaccaaggagtctcctgaagtctatctcggtgaacccaacaagatg
catctcgatggaactgctaagggtcccttcaacgcccacaatccgtacattgcccccatc
gcccagtcctatgagctcttctccgtcaaggaccgcaactgcattcacatggatattgat
atcagcgcctcaaacctcaactaccaaactggcgaccacatcgctgtttggcccacgaac
cctggtgatgaggttgatctcttcatgaacgtcttgggtctctccgataagcgccacact
gttgtcagcgtcaaggctctcgaggcaaccgccaaggttcccttcccgactcccaccacc
tacgacgctatcgttcgctaccacatggaaatttgcgctcccgtctcccgtcagttcctc
gctcagctcgctgcttttgctcccgatgcggagtccaaggccgaaatgaccaagctcggt
gccgaaaaggattacttccatgagaagatcagcgttcaccatctcaacatcgccagggtt
ttggatatcgtcggcaagggccagaaatggaccaacatccccttctctgctttcattgag
ggtatcaccaagctccagccccgctactactccatctcctcctcgtccctcgaacagccc
aagaagatttccatcactgcggtcgtcgaaagtacccagcttcccggtcgtgatgacccc
ttccgcggtgtcgccaccaactacctcctcgcactcaagcagaagcagaacggtgatccc
gagccctgccccttcggtcttacctacgaaatcaccggcccccgcaacaagtacgacggc
atccacgttcctgtccatgtccgccactcgaactttaagctcccctcggatccctccaag
cccatcatctgcattggtcctggtaccggtgtcgctcccatgcgtggtttcatccgcgag
cgcgtccagcaggccaagaacggcgagaaggttggcaagactctgctcttctttggctgc
cgcaagtctaccgaggatttcatgtacaaggacgaatgggaggaagccaagcaggtcctc
ggcgacaacttcgagctcatcaccgccttctcccgcgagggaaccaagaaggtctatgtc
cagcaccgtctcaaggaaagagccgaggagatcaaccagcttctcgagcaaaaggcctac
ttctacgtctgcggcgacgctgccaatatggcgcgcgaggttaacactgtcctggggaac
ataatttccgagcagagaggcattcccgaggccaaggccgaggagattgtcaagaacatg
aggtcggcgaaccagtaccaggaggatgtctggtcataa

DBGET integrated database retrieval system