KEGG   Sordaria macrospora: SMAC_04769Help
Entry
SMAC_04769        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 671 aa AA seqDB search
MAELDTLDLVVLAAILLGTVAYFTKGTLWGVTKDPYASSLANASGAKAGKTRNIVEKMEE
QGKNCIIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEEYDFDNLDTIPDDKVVFFV
LATYGEGEPTDNAVDFYEFITNEDVNFTEGNEPALGNLNYVTFGLGNNTYEHYNSMVRNV
DKALQKLGAHRIGDAGEGDDGAGTMEEDFLAWKEPMWTALAEKMGLEEREAVYEPVFSIV
EREGLTKESPEVYLGEPNKMHLDGTAKGPFNAHNPYIAPIAQSYELFSVKDRNCIHMDID
ISASNLNYQTGDHIAVWPTNPGDEVDLFMNVLGLSDKRHTVVSVKALEATAKVPFPTPTT
YDAIVRYHMEICAPVSRQFLAQLAAFAPDAESKAEMTKLGAEKDYFHEKISVHHLNIARV
LDIVGKGQKWTNIPFSAFIEGITKLQPRYYSISSSSLEQPKKISITAVVESTQLPGRDDP
FRGVATNYLLALKQKQNGDPEPCPFGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSDPSK
PIICIGPGTGVAPMRGFIRERVQQAKNGEKVGKTLLFFGCRKSTEDFMYKDEWEEAKQVL
GDNFELITAFSREGTKKAYFYVCGDAANMAREVNTVLGNIISEQRGIPEAKAEEIVKNMR
SANQYQEDVWS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactcgacacgctggacctcgtggtcctggcggccatccttctcggaacggtc
gcctacttcacaaagggcacactatggggcgttacaaaggatccttatgccagctccctg
gccaacgccagcggcgcaaaggctggcaagacaagaaacatcgtggagaagatggaggag
cagggcaagaactgcatcatcttctatggctcccaaaccggtactgctgaggattacgct
tcgagactcgccaaggagggcaagagccgcttcggtcttgagaccatggttgctgacctt
gaggaatacgactttgacaaccttgatactatccccgacgataaggtggtgttcttcgtg
ctcgccacctatggtgagggcgagcctactgataacgccgtggacttctacgagttcatc
accaacgaggacgtcaacttcaccgagggcaacgaacctgcgcttggcaacctgaactat
gtcaccttcggtctcggaaacaacacctatgagcattacaactccatggttcgcaatgtg
gacaaggcgctccagaagctgggcgcccaccgtatcggtgatgctggcgagggtgatgat
ggcgctggcaccatggaggaagatttcttggcctggaaggaacccatgtggactgctctc
gctgagaagatgggcttggaagagcgcgaggctgtttacgagcccgtcttcagcattgtt
gaaagggagggcctgaccaaggagtctcctgaagtctatctcggtgaacccaacaagatg
catctcgatggaactgctaagggtcccttcaacgcccacaatccgtacattgcccccatc
gcccagtcctatgagctcttctccgtcaaggaccgcaactgcattcacatggatattgat
atcagcgcctcaaacctcaactaccaaactggcgaccacatcgctgtttggcccacgaac
cctggtgatgaggttgatctcttcatgaacgtcttgggtctctccgataagcgccacact
gttgtcagcgtcaaggctctcgaggcaaccgccaaggttcccttcccgactcccaccacc
tacgacgctatcgttcgctaccacatggaaatttgcgctcccgtctcccgtcagttcctc
gctcagctcgctgcttttgctcccgatgcggagtccaaggccgaaatgaccaagctcggt
gccgaaaaggattacttccatgagaagatcagcgttcaccatctcaacatcgccagggtt
ttggatatcgtcggcaagggccagaaatggaccaacatccccttctctgctttcattgag
ggtatcaccaagctccagccccgctactactccatctcctcctcgtccctcgaacagccc
aagaagatttccatcactgcggtcgtcgaaagtacccagcttcccggtcgtgatgacccc
ttccgcggtgtcgccaccaactacctcctcgcactcaagcagaagcagaacggtgatccc
gagccctgccccttcggtcttacctacgaaatcaccggcccccgcaacaagtacgacggc
atccacgttcctgtccatgtccgccactcgaactttaagctcccctcggatccctccaag
cccatcatctgcattggtcctggtaccggtgtcgctcccatgcgtggtttcatccgcgag
cgcgtccagcaggccaagaacggcgagaaggttggcaagactctgctcttctttggctgc
cgcaagtctaccgaggatttcatgtacaaggacgaatgggaggaagccaagcaggtcctc
ggcgacaacttcgagctcatcaccgccttctcccgcgagggaaccaagaaggcctacttc
tacgtctgcggcgacgctgccaatatggcgcgcgaggttaacactgtcctggggaacata
atttccgagcagagaggcattcccgaggccaaggccgaggagattgtcaagaacatgagg
tcggcgaaccagtaccaggaggatgtctggtcataa

DBGET integrated database retrieval system