KEGG   Sordaria macrospora: SMAC_04802Help
Entry
SMAC_04802        CDS       T01610                                 

Gene name
rfa2
Definition
RFA2 protein
Orthology
K10739  
replication factor A2
Organism
smp  Sordaria macrospora
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SMAC_04802 (rfa2)
   03420 Nucleotide excision repair
    SMAC_04802 (rfa2)
   03430 Mismatch repair
    SMAC_04802 (rfa2)
   03440 Homologous recombination
    SMAC_04802 (rfa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MAGYGGYGGGDAGGFMAGSQQGGSQGGGSKYADESLRPVTIKQLLDWEDTYPGMDPTIDG
HPITQVTIVGQVRSVKPQPTNITYKIDDGTGAIDVKKWVDSEAQGEGENGSGAGAIAPDA
FVRVWGRLKSLGGKKHVSANFIRQIEDFNEVNYHLLEATYVHLFFSKGAAGAGGAKQDGG
GDSMFVDQGYGAGGGGADVAMGGAGPGGGNSAMRARLATCSRNAQTICNFINNSPGGTEG
VNLHVIAQGTRMNVRDIVNAADELLGQGIIYTTQDDETWAILDY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctacggcggatatggtggtggtgatgccggtggcttcatggccggatctcag
caaggtggtagtcaaggcggtggttccaagtacgccgacgaatccctccgccccgtaacc
atcaagcaactcctcgactgggaagacacctaccccggcatggatcccaccatcgatggc
caccccataacccaagtgaccatcgtgggccaagtgcgctcggtcaagcctcaaccgacc
aacatcacgtacaagatcgacgacggcacgggcgccatcgacgtcaagaagtgggtcgac
tcggaagcacaaggcgaaggcgagaacggcagcggcgccggtgctattgcccccgacgcc
tttgtccgcgtgtggggtcgtctcaagagcctcggcggcaagaaacacgtcagcgccaac
ttcatacgccagattgaggatttcaacgaggtcaattaccacctgctcgaggcgacatac
gtgcatctgttcttcagcaagggcgcagcaggtgccggtggcgcgaaacaagacggtgga
ggagacagcatgtttgtcgatcagggatacggagccggaggaggaggcgctgatgtcgct
atgggcggcgctggccctggtggaggaaacagcgcgatgcgggcgaggctggcgacgtgc
tcgcggaatgcgcagaccatttgcaacttcatcaacaactcgcctggcgggacagagggt
gtcaatttgcatgtgattgcgcagggcacgaggatgaacgttagggatatcgtcaatgcg
gcggacgagttgctgggacagggtatcatttacaccacgcaggatgatgagacgtgggct
attctggattattag

DBGET integrated database retrieval system