KEGG   Sordaria macrospora: SMAC_04810Help
Entry
SMAC_04810        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smp  Sordaria macrospora
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMAC_04810
   00052 Galactose metabolism
    SMAC_04810
   00500 Starch and sucrose metabolism
    SMAC_04810
   00520 Amino sugar and nucleotide sugar metabolism
    SMAC_04810
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMAC_04810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MAQAIRSALPDRLKPSNGDESEFTQRHHGKTRSHMAFENTSTNIAAAQMRNHLTDLAETV
KDPSQKKLFETEMDNFFSLFRRYLNDKAKGNEVTWDRIAPPAPHQIVDYESLANNDSVGF
LNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSVRQVEHLNRTYGSNVPILLMNS
FNTDEDTAAIIKKYEGHNVDILTFNQSRYPRIFKDSLLPVPKSFDSALHDWYPPGHGDVF
ESLYNSGILDKLIERGIEIIFLSNADNLGAVVDLRILQHMVETDAEYIMELTNKTKADVK
GGTIIDYDGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNVNAIKRVVENNELELE
IIPNGKTIPGDKKGESDISILQLETATCSDLMLVKSDLYTVKHGQLQMSSARFGDAPLIK
LGNDFKKVSDFQKRIPSIPKIIELDHLTITGAVNLGRGVTLKGTVIIVATEGQTIDIPPG
SILENVVVQGSLRLLEH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagcaatcaggagcgccctccccgaccgcctcaagccttccaacggcgacgag
tccgagttcacccagaggcaccatggcaagactagatcccacatggctttcgagaacacc
tcgacaaacattgctgccgcccagatgcgcaaccacctcacagacctggccgagacggtc
aaggaccccagccagaagaagctctttgagaccgagatggacaacttcttctccctcttc
cgtcgctacctgaacgacaaggccaagggcaacgaggtcacctgggaccgcattgctcct
cctgcccctcatcagatcgtcgactacgagagcctcgctaacaacgactcggtcggcttc
cttaacaagcttgccgtcctcaagctcaatggtggtctcggtacctccatgggttgcgtc
ggccccaagtccgtcatcgaagtccgtgatggcatgtctttcctcgacatgtccgtccgc
caggttgagcacctcaaccgcacctatggctccaacgtgcccatcctcctcatgaactcg
ttcaacaccgatgaggacactgctgccatcatcaagaagtacgagggccacaacgtcgac
atcctcaccttcaaccagtcccgctaccccagaatcttcaaggactccctcctccccgtc
cccaagtcctttgactctgctctccacgactggtaccctcccggccacggtgacgttttc
gagtctctctacaactctggcattctcgacaagcttattgagcgtggtatcgagatcatc
ttcctctccaacgccgacaacctcggcgccgtcgtcgatctccgcatcctccagcacatg
gttgagaccgatgccgagtacattatggagcttaccaacaagaccaaggccgatgtcaag
ggtggtaccatcatcgactacgatggctccgtccgtctcctcgagatcgcccaggtcccc
aaggagcacgtcaacgagttcaagtccatcaagaagttcaagtactttaacaccaacaat
atctggatgaacgtcaacgccatcaagcgcgtcgtcgagaacaacgagctcgagctcgag
atcattcccaacggcaagaccatccccggcgacaagaagggcgagtccgacatcagcatt
ctccagctcgagaccgccacctgctccgatctcatgctcgtcaagtcggatctctacacc
gtaaagcacggccagctccaaatgagctctgcccgcttcggtgacgctcccctcatcaag
ctcggtaacgacttcaagaaggtgtcggacttccagaagcgcatccccagcattcccaag
atcatcgagcttgaccacctcaccatcactggtgccgtcaacctcggccgtggcgtcacc
ctcaagggcaccgttattattgtggccactgagggtcagaccattgacattcctcccgga
tccatcctcgagaacgttgtcgtccagggtagcttgcgcctccttgagcactaa

DBGET integrated database retrieval system