KEGG   Sordaria macrospora: SMAC_04833Help
Entry
SMAC_04833        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smp  Sordaria macrospora
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_04833
Enzymes [BR:smp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SMAC_04833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 346 aa AA seqDB search
MVDRARKPSALATTPGLPPQPQVAFSSDNSSVTATLPTGESVSVLLYGATVVSWKDKNGD
EKLWLSEAAKLDGSKPVRGGIPLVFPVFGTAPDHAQTKSLPQHGFARSSRWEFLGKSTSE
STPTPTTPAFAATATSAAGAVAAAAADMSVKLDFGLSSSSLSEDARQKWPYAFNAIYSVT
LNTDSLTTNLVVTNDDERSWECQVLMHTYLRVDDITTTSITGLSSASYIDKTTSPISTNT
QTSPVLTISSETDRVYTPAGDSPASVPITVLSNDKPKFTVLRDNLSNVVVWNPWIEKAKG
MADFEPKEGYKNMLCVEPGAVGTWQVLEPGDALEGAQTIVLGGKTE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccgagcccgcaagccctccgccctagccaccaccccgggtctcccccctcag
ccgcaagtcgctttctcctccgacaactcctccgtgaccgccaccttgcctaccggcgaa
agtgtctcggtcttgctctacggagctaccgtcgtcagctggaaggacaagaatggcgat
gagaagttgtggttgagtgaggcggccaagttggatgggagtaagcctgttaggggaggg
attccgttggtttttcctgtcttcggcacagcccccgaccacgcccaaaccaagtccctc
ccgcagcacggcttcgcccgctcttcccgctgggaattcctcggcaagtccacctcggaa
tccactcccactccgacaacccccgccttcgccgcgacggccaccagcgccgccggagcc
gtggctgctgccgccgccgacatgtctgtcaagctggatttcggactgagctcgtcgagc
ttgagcgaggatgctagacagaagtggccatatgcgtttaatgcgatttacagcgtcacg
cttaacacggatagcttgacgacgaacttggtcgtgacgaatgatgatgagaggagttgg
gagtgtcaggttttgatgcatacttatttgagggttgatgacatcaccacaacctccatc
accggcctctcctccgcctcctacatcgacaaaaccacctctcccatctccaccaacacc
caaacctcccccgtgctaaccatctcctccgaaaccgaccgcgtctacacccccgccggc
gactcgcccgcctccgtgcccatcaccgtcctgtcgaacgacaagcccaagtttactgtc
ctccgcgataacttgtccaatgtcgtcgtctggaacccctggattgaaaaggcgaagggt
atggcggactttgagccaaaggaggggtataagaatatgttgtgcgtggaaccgggtgcc
gtgggtacgtggcaggttttggaaccgggagatgcgcttgagggtgcgcagactattgtt
ttgggtgggaagacggagtga

DBGET integrated database retrieval system