KEGG   Sordaria macrospora: SMAC_04973Help
Entry
SMAC_04973        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
smp  Sordaria macrospora
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SMAC_04973
Messenger RNA biogenesis [BR:smp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SMAC_04973
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SMAC_04973
Translation factors [BR:smp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SMAC_04973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MSEQVDLTTIPISPEGGNTNGDAAAKKAKDDKTVTVFHDKENFNVKHPLSNRWTLWFTKP
SSGKGDNWNDLLKEVITFETVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQNK
HGGKWSYQFKEKRSVNIDEIWLHTMLAAIGETLEDEEDGEVMGVVVNVRKAFFRVGVWTR
TIGKHIPGRGDGDVSGGKGRSPEKGKEILMAIGRRFKEVLQLPANEALEFSGHTESAHSG
SSRARAKMTV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcaagtcgatctcaccaccatccctatcagccccgagggcggcaacaccaac
ggcgacgccgccgctaagaaggccaaggacgacaagaccgtcaccgtcttccacgacaag
gagaacttcaatgtcaagcaccctctctccaaccgctggaccctttggttcaccaagccc
tcaagcggaaagggcgacaactggaatgatctcttgaaggaggttatcacctttgagacg
gtcgaggagttctggggtgtatataacaatatcgctcccgtatcagagctcgctctcaag
tccgattaccatctcttcaaggagggcgtccgccccgagtgggaggatccccagaacaag
cacggtggcaagtggtcttaccagttcaaggagaagcgcagtgtcaacattgacgagatc
tggctgcatactatgcttgctgcgatcggcgagactctcgaggacgaggaggacggcgag
gtcatgggtgttgtcgtcaacgtccgcaaggccttcttccgtgttggtgtctggactcgc
accatcggcaagcacattcccggccgcggcgacggcgacgtttctggcggcaagggtagg
tcccctgagaagggcaaggagatcctgatggccattggccgtcgcttcaaggaggtcctc
cagctccctgccaacgaggctctcgagttctccggccacacggaatccgctcacagcggc
agctctcgcgctcgtgccaagatgaccgtctaa

DBGET integrated database retrieval system