KEGG   Sordaria macrospora: SMAC_04993Help
Entry
SMAC_04993        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K05916  
nitric oxide dioxygenase [EC:1.14.12.17]
Organism
smp  Sordaria macrospora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MALTYQQTKLVKDTIPALKEHGERITSIFYKTMLTDHPELNNYFNSVNQKNGRQPRALTA
VILGFAANINHLSELVPKFERMCNKHCSLGIQPEHYEVVGKYLIQAFGEVLGPAMTPEVQ
TAWTKAYWMLAKMLIGREVQLYRDFESWSSWRPFKIDRIVNECDDLYSFYLVPQDGKRLP
RYLPGQYISVQIQIPNGYLQSRQYSLSEAWREDYYRITVRRDEGTVYSNSVSKSFFNPGT
VSNYLIDQTTVGSVLKVSHPAGEFFLDINNTSTMPLVLISAGVGVTPMVSIANTVMENQP
GRQIAWVHGCRKHVPFEEHIRDMRKKNCNFHTKIFKTVINSTDRPGETYDYNERMDLAKL
KPEELYLQHGGTEYFICGPEQFMINQKFYLMQQGVPASRIKCEIFTTGDLVFKQG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctcttacataccagcagaccaagctggtcaaggacaccatccccgctctcaaagag
cacggcgagaggataacaagcatcttctacaagactatgctcaccgaccatcccgaactc
aacaactacttcaactcggtaaaccagaaaaatggcaggcaacctcgtgccctgacggcc
gttatcttgggctttgccgcaaacattaaccacctcagcgaactcgtacccaagtttgag
cgcatgtgtaacaagcactgctcattaggtattcagccagagcactacgaggttgtcggc
aagtatctcatccaggcttttggagaggtcttgggccccgcgatgacacccgaggtgcag
acggcatggacaaaggcgtactggatgttggccaagatgttgatcgggcgcgaggtacaa
ttgtacagggactttgagagctggtcctcttggcgtccctttaagatcgacagaatcgtc
aacgagtgcgacgacctctactccttttaccttgtgcctcaggatggaaagcggttaccg
agatatctccctggccagtacatctccgtccagatccagatccccaacggctaccttcag
tccagacagtactccctcagtgaggcttggagagaggactactaccgtatcaccgtccgc
cgcgacgagggtaccgtgtactccaactccgtttccaagtccttcttcaatcccggcacc
gtctccaactaccttatcgatcagaccaccgtcggctctgtcctcaaggtctcccacccg
gccggcgagttcttcttggatatcaacaacaccagcaccatgcccctggtcttgatctct
gccggtgtcggcgtcacccccatggtttccatcgccaacactgttatggagaaccagccc
ggccgtcagattgcttgggtacatggctgccgcaagcacgtccccttcgaggagcacatc
agggatatgcgcaagaagaactgcaacttccacaccaagatcttcaagaccgtcatcaac
agcactgatcgccctggcgagacatatgactacaacgaacgcatggacctggccaagctc
aagcccgaggagctctatctccagcatggcggcactgagtacttcatctgcggcccagag
cagttcatgatcaaccaaaaattctacctcatgcagcagggcgtccctgcctcgcgcatc
aagtgcgagatcttcaccacgggagatctggtgttcaaacaaggatga

DBGET integrated database retrieval system