KEGG   Sordaria macrospora: SMAC_04993Help
Entry
SMAC_04993        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K05916  
nitric oxide dioxygenase [EC:1.14.12.17]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     SMAC_04993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MALTYQQTKLVKDTIPALKEHGERITSIFYKTMLTDHPELNNYFNSVNQKNGRQPRALTA
VILGFAANINHLSELVPKFERMCNKHCSLGIQPEHYEVVGKYLIQAFGEVLGPAMTPEVQ
TAWTKAYWMLAKMLIGREVQLYRDFESWSSWRPFKIDRIVNECDDLYSFYLVPQDGKRLP
RYLPGQYISVQIQIPNGYLQSRQYSLSEAWREDYYRITVRRDEGTVYSNSVSKSFFNPGT
VSNYLIDQTTVGSVLKVSHPAGEFFLDINNTSTMPLVLISAGVGVTPMVSIANTVMENQP
GRQIAWVHGCRKHVPFEEHIRDMRKKNCNFHTKIFKTVINSTDRPGETYDYNERMDLAKL
KPEELYLQHGGTEYFICGPEQFMINQKFYLMQQGVPASRIKCEIFTTGDLVFKQG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctcttacataccagcagaccaagctggtcaaggacaccatccccgctctcaaagag
cacggcgagaggataacaagcatcttctacaagactatgctcaccgaccatcccgaactc
aacaactacttcaactcggtaaaccagaaaaatggcaggcaacctcgtgccctgacggcc
gttatcttgggctttgccgcaaacattaaccacctcagcgaactcgtacccaagtttgag
cgcatgtgtaacaagcactgctcattaggtattcagccagagcactacgaggttgtcggc
aagtatctcatccaggcttttggagaggtcttgggccccgcgatgacacccgaggtgcag
acggcatggacaaaggcgtactggatgttggccaagatgttgatcgggcgcgaggtacaa
ttgtacagggactttgagagctggtcctcttggcgtccctttaagatcgacagaatcgtc
aacgagtgcgacgacctctactccttttaccttgtgcctcaggatggaaagcggttaccg
agatatctccctggccagtacatctccgtccagatccagatccccaacggctaccttcag
tccagacagtactccctcagtgaggcttggagagaggactactaccgtatcaccgtccgc
cgcgacgagggtaccgtgtactccaactccgtttccaagtccttcttcaatcccggcacc
gtctccaactaccttatcgatcagaccaccgtcggctctgtcctcaaggtctcccacccg
gccggcgagttcttcttggatatcaacaacaccagcaccatgcccctggtcttgatctct
gccggtgtcggcgtcacccccatggtttccatcgccaacactgttatggagaaccagccc
ggccgtcagattgcttgggtacatggctgccgcaagcacgtccccttcgaggagcacatc
agggatatgcgcaagaagaactgcaacttccacaccaagatcttcaagaccgtcatcaac
agcactgatcgccctggcgagacatatgactacaacgaacgcatggacctggccaagctc
aagcccgaggagctctatctccagcatggcggcactgagtacttcatctgcggcccagag
cagttcatgatcaaccaaaaattctacctcatgcagcagggcgtccctgcctcgcgcatc
aagtgcgagatcttcaccacgggagatctggtgttcaaacaaggatga

DBGET integrated database retrieval system