KEGG   Sordaria macrospora: SMAC_05223Help
Entry
SMAC_05223        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smp  Sordaria macrospora
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMAC_05223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMAC_05223
   00630 Glyoxylate and dicarboxylate metabolism
    SMAC_05223
Enzymes [BR:smp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SMAC_05223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MASVETLLQGVTILGPIEEHQRKILTPQALSFVALLHRSFNQTRKNLLERRKIRQAEIDR
GVLPDFLPETKHIRENPTWKGAPPAPGLIDRRVEITGPTDRKMVVNALNSDVYTYMADFE
DSSAPTWANMVNGQVNLYDAIRRQIDFKQGQKEYKLRTDRTLPTLIVRPRGWHLEEKHIT
IDGEPVSGSLFDFGLYFFHNAKELIKRGFGPYFYLPKMESHLEARLWNDAFNLAQDYIGI
PRGTIRGTVLIETILAAFEMDEIIYELREHSSGLNCGRWDYIFSTIKKFRNHSSFVLPDR
SCVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKDDKAANDKAMEGVRADKLREA
RAGHDGTWVAHPALASIALEVFNKHMPTPNQLFNRREDVQIGQQDLLNMNVPGSITEEGI
RKNLNIGLGYMEAWIRGVGCVPINYLMEDAATAEVSRSQLWQWVKHGVTTAEGKRVDKGY
ALKLLKEQTDELAAKAPQGNKFKLAAQYFATQVTGEDYADFLTSLLYNEITSAGNSLPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtcgagactcttctccagggcgttaccatcctcggccccattgaggagcac
cagaggaagatcctgactccccaggctctctccttcgtcgccctcctccaccgttccttc
aaccagacccgcaagaacctcctcgagcgccgcaagatccgccaggccgagatcgaccgc
ggtgtccttcccgacttcctccccgagaccaagcacatccgtgagaaccccacatggaag
ggtgcgcctcccgctcccggtctcatcgaccgtcgcgttgagatcaccggccccaccgac
cgcaagatggtcgtcaacgcccttaactccgatgtctacacctacatggccgacttcgag
gactccagcgcccctacctgggccaacatggtcaacggccaagtgaacctctacgacgcc
atccgtcgccagatcgacttcaagcagggccagaaggagtacaagctccgcaccgacagg
actctccccaccctcatcgtccgcccccgtggctggcaccttgaggagaagcacatcacc
attgacggcgagcccgtcagcggttccctcttcgacttcggtctctacttcttccacaac
gccaaggagctcatcaagcgcggcttcggcccctacttctaccttcccaagatggagtct
caccttgaggcccgtctctggaacgacgccttcaacctcgcccaggactacattggcatt
ccccgcggcaccatccgtggtaccgtcctgattgagaccatcctcgctgccttcgagatg
gacgagatcatctacgagctccgtgagcactcctccggtctcaactgcggccgttgggat
tacatcttctccaccatcaagaagttccgcaaccactcctctttcgtcctccccgaccgc
tcttgcgtcaccatgaccgtccccttcatggacgcctacgtcaagctcctcatccagacc
tgccacaagcgcggcgttcacgccatgggtggcatggctgctcagatccccatcaaggac
gataaggccgccaacgacaaggccatggagggtgtccgcgccgacaagctccgcgaggcc
cgcgccggccacgacggtacctgggttgctcaccccgcccttgccagcatcgcccttgag
gtcttcaacaagcacatgcctacccccaaccagctcttcaaccgccgtgaggacgtccag
attggccagcaggatctgctcaacatgaacgtccccggctccatcaccgaggagggtatc
cgcaagaacctcaacattggtctcggctacatggaggcctggatccgtggtgtcggttgc
gtccccatcaactacctcatggaggatgccgccaccgccgaggtctctcgctcccagctc
tggcagtgggtcaagcacggcgtcaccaccgccgagggcaagcgcgtcgacaagggctac
gccctcaagctcctcaaggagcagaccgacgagctcgccgccaaggctccccagggcaac
aagttcaagcttgccgctcagtacttcgccacccaggttaccggcgaggactatgccgac
ttcttgacctcgctcctctacaacgagatcaccagcgctggtaactcgttgcctgcttcc
aagctctaa

DBGET integrated database retrieval system