KEGG   Sordaria macrospora: SMAC_05287Help
Entry
SMAC_05287        CDS       T01610                                 

Gene name
cdc27
Definition
CDC27 protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
smp  Sordaria macrospora
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SMAC_05287 (cdc27)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SMAC_05287 (cdc27)
   04113 Meiosis - yeast
    SMAC_05287 (cdc27)
Protein phosphatases and associated proteins [BR:smp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SMAC_05287 (cdc27)
Ubiquitin system [BR:smp04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SMAC_05287 (cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 815 aa AA seqDB search
MTPNNVTVSLLLRQAIYYHLDNCAYESALFFAERLYAHDQSFCDSAYLLAYTHLRLGDAR
TAYQVSRGLGYRGTHLGSCYVFAQACLELERYKDGITGLENGRKQWSKADNLGKHTSFTR
MPYPDAAAFSCLLGRLYRAYDDKKKAIPCFEEALRRNPFMWEAFTSLCDMGVSVRVPNVF
KTSDGLARNLEHGLDATSILAWIAGPSPQPPEPLQQKKMGQQQKRQPSDPFGPCGTSQES
ASYPDSENGFISKMYPSQSENTSSQPGKPFEESETQPAPATTAHNPHVGRAGRQAEPPQA
PPRRTRAAQATDSALADAPPKMGHRLGTRKKDKAQESTTDHADPNAKTSTVSSSTTERKR
TAAGHPVQTRSMNSDEPRRSARLNVGSRSTATKTSSTAATRELRKARPPITRFARPGSSG
ANVGRVISGNRKPPPEDHGMDIDHAEASRAKEPPVVQVAPHLPPAPKPAESESVKAVEEA
LKTIFDLLKKLGSGYSLSSEFQCQEAVAAYISLPRSHQDTPWVLAQMGRTQYEQANYAEA
EKYFKRLRVIAPTRLEDMEVYSTVLWHLKKETELSFLAHEMIDSVWDSPEAWCALGNAWS
LAYDHEQALRCFKRATQLDPKFAYAYTLQGHEHVENEEYDKALTAYRHAIAADKRHYNAY
YGIGRVYEKLGNYDKALSHYHAASVIHPTHAVLICCMGSVLHKQKQIKQALPYFTRAAEL
APRAPDVRLKKARALLQMGQTKAAQTELMILKDLAPDRAQVHFLLGKLSKTLHDKKSAVR
HFTIALSLDPKASLQIKEAIESLEDDDGPDDSMMQ
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaaataatgttaccgtctcccttttgctacgccaggccatttattatcatctc
gacaactgtgcctacgagagcgccctcttctttgccgaacgactttatgcccacgaccaa
tccttctgcgattccgcctatcttctcgcctacacccacttgcgacttggtgatgctcga
actgcctaccaggtcagtcggggcctggggtatagaggcacgcatctgggatcctgctac
gtcttcgctcaggcgtgtttggagttggagcgatacaaagatgggatcacaggcttggaa
aatgggaggaaacaatggtccaaggcggacaacttggggaaacacacctcttttaccagg
atgccatatcccgatgccgccgccttcagctgtctcctgggcagactctaccgagcatac
gacgacaagaagaaggctataccatgttttgaggaggcactacgacgaaacccgttcatg
tgggaagccttcacaagcctttgcgatatgggagtgagcgttagagtgcccaacgttttc
aagacgagcgacggtcttgcgcgcaacctcgagcatggccttgacgctacgtccatcctt
gcctggattgcaggtccctctccacagccaccagagccattgcagcaaaagaagatgggg
cagcaacagaaaaggcagccaagcgatcccttcgggccatgtggaacatcccaggaatca
gcgtcgtacccagattcagaaaatggctttatatccaagatgtatccttctcaatccgaa
aatacatccagtcagcccggaaaaccattcgaggaaagcgaaacgcaacccgcgcctgct
accaccgctcataatcctcatgttggtcgtgctggacgccaagcagagccgccgcaagca
ccgcctcgaagaacccgggcagcccaggcaacggattctgcgttagctgatgcgccgccc
aaaatgggccaccggctgggaacaagaaagaaagacaaagcccaagaatcaaccacagat
catgcggacccaaacgccaaaacatcaacggtctccagctcaactactgaaaggaaacgc
acggcagcggggcacccagtccaaaccagatcaatgaacagtgatgaacccaggcgaagc
gcaaggctcaatgtgggctcaagatcgacggcaaccaagacatcgagcacggcagcaacc
cgtgagctgaggaaggctaggcccccaataactcgatttgctcggccgggctccagtgga
gcaaacgttggtcgggtcatcagtggcaaccgcaagccgccaccggaggatcatggtatg
gacattgaccacgccgaggcatcacgcgccaaggagccccctgtggtgcaggtagcacca
catctgccacccgcccctaaaccagcggagtctgagtcggtcaaggcggttgaggaagct
ttgaaaacaatattcgatttgttgaaaaagctgggatcgggttattcgctctcatctgag
ttccagtgtcaagaggcagtcgcggcctacatatcactcccccggagtcaccaagacaca
ccgtgggttttggcacagatgggaaggacgcagtacgagcaggccaactatgccgaggca
gagaagtattttaagcgtcttcgcgttattgctccaactcggcttgaggacatggaggtc
tactcgactgttctgtggcatttgaagaaagagacggaactttcattcctcgcccatgag
atgatcgactcggtgtgggattcaccagaagcttggtgcgctcttgggaacgcatggtca
ttggcatatgatcacgagcaagccttgagatgcttcaagcgggcgacgcaacttgatccc
aaatttgcgtacgcctatactctacaaggacacgagcatgtagagaacgaggaatacgac
aaggccctcacggcctaccgacacgccattgcggcggataagcgccactacaacgcttat
tacggcatcggaagggtctacgagaagctgggcaactacgacaaggcgctgagccattat
cacgctgcttcggtcatccatccgactcacgcggtgttgatctgctgcatgggctcggta
ttgcacaaacagaaacagatcaagcaggcactgccctacttcaccagagcggccgaactg
gctccgcgcgctccagatgtccgactaaagaaggctcgtgcccttttgcagatgggacaa
acgaaggcggcacagacggaactcatgattctgaaggacttggccccggacagggcccag
gtgcatttccttttgggcaagctctccaagacactgcacgataagaaatcggcggtgcgc
cattttaccattgctctgagcttggacccaaaggcgagcctccaaatcaaggaagccatc
gagagcttggaggatgacgatggaccggatgattccatgatgcagtga

DBGET integrated database retrieval system