KEGG   Sordaria macrospora: SMAC_05293Help
Entry
SMAC_05293        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SMAC_05293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MSTPTTATATLHRSYSDRYHPQFASYQHHHQPYPVQANSASSFYSQNTTNLPSILSPTAS
RQPFPDSPSTQYSLVDHQPPPVNPPPPLIANPVVLKPITRTLPPPHPRLSQQLPPQRLTL
QPGPDHTAMATPPNPEASQPASQQNKRKRQRGETNWAEFYINGLPKEVIVIDDTPEPEGT
ATRSVASQTLSNGAQVVTNQSAPSQPTAKRSRPNDHYDPVHHNQYVPSQNQAPRSLPSAS
NSLNSPAATSNRTNSAQNTTTATSLGSLSSQSYNDDYAQPGAKRRKLTRQQANEAKRRET
AHADTFAVYKPPPYPPKKAGEVHVKVIADTSPNRGNNVDDDDGHMIVVPGNDLTDRYEII
KLLGQGTFGKVVQAKDKRRNKLVAVKIIRSVQKYRDASKIELRVLATLKANDEENRNRCI
HLRDCFDFRGHICIVMDLLGQSVFDFLKENNFVPFPNSQILAFARQLFTSVAFLHDLNLI
HTDLKPENILLCNQEYQTFTYSRTIPSSSTLTNRRAVHRKVLLDTEIRLIDFGSATFQDE
YHSSVVSTRHYRAPEIILGLGWSFPCDIWSIGCILVEFYTGDALFQTHDNLEHLAMMEAV
VNHKIDPALVQQVNRMTRNGGNPAAKFFKRSKLDYPAPDTTRASKRFVKGMKSLDEIIPA
RNSRFLSLFLDLLKKIFTYDPNKRITAREALQHEWFREHLPPDDGTEATRIRLEKETERQ
RREAEARRNMLPAMHSA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcccacaaccgccacggctacgctgcatcgctcctattcggaccggtaccat
ccgcagtttgcatcgtatcagcatcatcaccagccttatcccgtccaggccaacagcgcc
tcctccttttattcccagaatactaccaatctccccagcattctgtcgcccacagcgtca
cggcaaccatttccagactctccttcgacacagtactcgctcgtcgaccaccaaccacca
ccagtcaacccgccgccgcctctgatcgcaaacccggtcgttctcaagcccatcacccga
acattaccgccccctcacccgcgtctgtctcaacaacttcctccccagcgtttgaccctc
caacctgggcccgatcatacagccatggcgacacctcccaaccctgaggcgtctcagccc
gcctcacagcagaacaagaggaagaggcaacgcggagagaccaactgggcagagttctac
ataaacgggttacctaaggaagtaattgtgattgatgacactccagagcccgagggcacg
gctactaggagcgtggcctctcaaacactgtctaatggcgctcaggtcgtcacgaaccag
tcagctccatctcagccgacagctaagaggtccaggccaaatgaccattacgaccccgtc
caccacaaccaatatgtcccttcccagaaccaagcgccgcgttcgctaccgtccgcttcc
aattcgctcaactcccccgcggctactagcaatagaacaaactcggcccagaacaccacg
acagcaacttcgctaggctctctctcatcgcagagttacaacgatgattacgcacaaccg
ggtgcaaaacgcaggaagctaacccgacagcaggccaatgaggccaagcgtcgggaaacg
gctcatgccgatacctttgccgtgtacaaaccgcctccatatcctcccaagaaggccggt
gaagtacatgtcaaggtcattgcagacacttcgcccaatcgaggaaacaatgttgacgat
gatgatggtcatatgattgtggttcccggcaatgatcttaccgatagatacgaaatcatc
aagctccttggccaaggcactttcggcaaagttgtacaggcaaaggacaagaggcgcaat
aagcttgtcgcggtaaagatcatccgctccgtacagaagtacagagacgcgagtaagatt
gaactgcgggtgctggcaaccttgaaggcgaacgacgaggagaatcggaaccgttgcatt
catctgcgggactgcttcgatttccgtggccacatttgcatcgtcatggatttgcttggg
cagagcgtgtttgacttcctgaaggagaacaattttgtgcccttccccaacagtcaaatc
ctggcctttgctcgtcagttgtttaccagcgtcgctttcttgcacgacctcaacctgatt
cacaccgatctcaaacccgagaacatcttgctctgcaaccaagagtatcagacgtttacc
tactcccgcaccattccgtcatcttcaacgctcaccaaccgccgagccgtgcatagaaag
gttcttctagacaccgaaatcaggctcatcgactttgggtccgccacattccaggacgaa
taccattcatcagttgtgagcactagacattatcgtgcgcccgagattattctcggtctg
gggtggtccttcccctgtgatatatggagcattggctgcatcctggtagagttctacaca
ggtgacgctttgttccagacgcacgataacctggaacatctggcaatgatggaggcagtg
gtgaaccacaagatcgatcctgcgttagtccagcaggtcaacaggatgaccaggaatggt
ggcaatccggctgcgaagttcttcaagcgctcaaaattggactaccctgctcccgacacc
acccgtgcgtccaagagattcgtcaagggcatgaagtctctcgatgaaatcatccctgcc
agaaatagtcgcttcctttctctgttcctggatcttctaaaaaagatctttacatatgac
cccaacaagcgtatcaccgccagggaagcccttcagcacgaatggttccgagagcacctc
ccaccagatgacggtaccgaggccacccgaatcaggctcgaaaaggagacagaaagacag
cgtcgagaggcggaagcgcggagaaatatgctaccggccatgcactcagcatga

DBGET integrated database retrieval system