KEGG   Sordaria macrospora: SMAC_05383Help
Entry
SMAC_05383        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
smp  Sordaria macrospora
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SMAC_05383
Enzymes [BR:smp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SMAC_05383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1224 aa AA seqDB search
MSQISDADVSGKPDTVSVPGLESDIPLLEDEEQNEAHQQLQQEQQGAGQGITEAQPDAVV
AVPQQPAEPSLPDQQPGPDTKSRPRRARGNNAPVYNLARLTGTYVHGKRASKGDIVLQKK
RKPKGRKLQALLAQQALEAEQAAQAALLLAFQGKTPAEPAANIPSVEPANQETDKPDSNA
PVDAPAIPPVHAPVAPETTITEPTISESTIPESTIPEPPIAEPTISEPTIPEPTILEPTI
AEPIIPEPTIAEPTIPESTIPEPEIPKVAASPDQHGAAQPPDAPADESRVDHESLDASMD
EAPLEFPTDTVELSTTTDADTAQTIHPYISDTLAPALPADVPNHIPPIAPSATTKPSTRG
AKATNKDVVKRPVGRPRKSTATNAGKATRRAMAKTAKTRTATAEEAQLDVEKEAEPSSTE
DGQTGTWEDVPEETNGDVQTSPAKRVKAVKAKGVKTAKGKVTKAGTIKASAVVPATRRAT
RHSGVPVEDPLFSLIPPAPPLGKKTKKTAEPALTRVPRELKRLRDTNEFVGIDTRPIRYS
VWSNGKYIEVTEDSEPTAPAKKKARVESSTATVREEKKEKMVEPEAPINTESSRPVVQQK
RVKKWLNKGLYAGQQAPEDVRESLTKQERKKLLAIPELAKSSPPNNVLPLPIFNGLRLLI
TGRDFKLPFDVCHPLPPGQPKPAAYRTMTKNRFIGQAAAIWKKTPHFEDFASKCVCTPED
GCAQDCQNRVMLYECDETNCNVGKEFCQNRAFQMLTERTKQGGRYRVGVEVFKTEDRGYG
VRSNRCFEPHQIIMEYTGEIITDEECERRMNEEYKNNECYYLMSFDQNMIIDATTGSIAR
FVNHSCSPNCRMIKWIVSGQPRMALFAGDRPIQTGEELTYDYNFDPFSAKNVQKCLCGAP
NCRGVLGPKPKEVKPPKPPKAEGKGKKKAVKRKLQELLANRVIVEGDEKSPKKLKVAKST
EDTAKGAATFLSRKVSKVSVSAKSKAASAKTIKTFARKVSIASTKVVKSFSKGAAAKSKM
ITLKAPTRGSNLTIVAADSGGSITAAGTTEAEEEVGNKASRAARATPKNTPRAKKTADAV
QETPAAAEDDGGSVFDVPSSSSARKRAPSWKVRDSGVKNVSSLFKKARKSPVKSKDTASP
AATSTAVTKVVKTRKASTSAKVTKPGKAMPKLTVAMKTGKSVTKTTASKSGKGSVSTKSA
TKIRLVSKPADGQDENAAPEQVEA
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagatctccgacgccgatgttagtggcaaaccagataccgtttccgtacccggt
ctagagagcgacatccctttactagaggacgaagaacaaaacgaggctcaccaacagttg
caacaagaacaacaaggggctggccaagggataacagaggcccaaccagacgccgttgtt
gcggttccccaacaacccgcggagccctcattacccgaccaacaacccggtcctgacaca
aaaagtcgaccgcgccgtgcacgaggcaacaacgcccccgtatacaaccttgcgagattg
accggcacctatgtgcatggcaaacgcgcctcgaaaggtgacattgttctccagaaaaag
cggaaaccgaaaggcagaaagctacaggctctactagcccagcaggctctcgaagctgag
caggccgctcaagccgcgctgctgctagcctttcagggcaaaactcctgcagagcctgcc
gcaaacatcccatctgttgaaccagccaaccaggaaaccgacaagcccgactcgaacgcg
cccgtagacgcgcccgcgatcccgcctgtccacgcgcccgtagcccccgagaccacgatc
accgagcccacgatctccgagtccacgattcccgagtccacgattcccgagcccccgatc
gccgagcccacgatctccgagcccacgattcccgagcccacgattctcgagcccacgatc
gccgagcccataattccggaacccacgatcgccgaaccaacgattccggaatccacgatc
cctgagcccgagatccccaaagtcgctgctagtcccgaccagcatggcgccgctcaacca
cccgacgctccagccgacgaaagtcgcgtggatcacgagagtctcgacgcgtcgatggat
gaagcgccgcttgaattccctacagataccgtcgaactgagcacgacgacagacgccgat
accgcgcaaaccatccacccctacatcagcgacacgctggctcccgccctaccagccgat
gttcccaaccatattcctcctatcgcgcccagcgcaaccacaaagcctagcacaagggga
gccaaggcaaccaataaggacgttgtcaagaggcctgttgggagaccaaggaaaagcacg
gcgacaaatgcaggcaaagcaaccaggagagccatggccaaaacagccaagaccaggacc
gccaccgccgaggaagcccaacttgatgtcgagaaagaagcggagccaagcagcaccgaa
gacggacaaacaggcacatgggaagatgtcccagaagaaacaaatggagatgtacaaaca
agcccagccaaacgagtcaaagcagtcaaagcgaagggagtcaaaacagccaaaggcaag
gtaacgaaagctgggacgatcaaagcctccgccgtcgtccctgctacgcgcagagcgacg
cgtcattcgggtgtccccgttgaagaccctctcttttcattgataccaccggcaccgcca
ctgggcaaaaagaccaagaagactgccgagcctgctttaactcgtgttccacgcgagctg
aagcgcttacgagatacgaacgaattcgttggcatcgacacccgtccaattcggtactct
gtttggagcaacggaaagtacatcgaggtaaccgaggacagtgagcccactgcaccagca
aagaagaaggccagggttgagagcagcacagccacagtacgcgaagagaagaaggagaag
atggtggaaccggaggctccgataaacaccgaatcttctcgtccagttgtccagcaaaag
cgcgtaaagaagtggctcaataagggtctctacgctggccagcaggcgcctgaggacgtc
agagaaagcctcactaagcaagagaggaagaagctcctggctatcccagaactcgcaaag
agtagcccgccgaataacgtccttccactaccaatcttcaacggactacggctgctcatc
acaggtcgtgatttcaagctaccgtttgatgtctgccatccattacctcctggacagccc
aagcccgccgcataccgcaccatgacaaagaaccgtttcatcggccaggccgcggcaatt
tggaagaagactcctcactttgaggattttgcttccaagtgtgtatgtacgcctgaagac
ggatgcgcacaagactgccagaatcgggtcatgctgtacgagtgtgatgagacaaactgc
aacgtcggcaaagagttctgccaaaaccgagctttccagatgctcacagaaagaaccaag
caaggaggtcgttaccgcgtaggtgttgaggtcttcaagaccgaagacagaggatatggt
gtgcgtagcaaccgctgctttgaaccccaccagatcattatggagtacacaggcgagatc
attaccgatgaggagtgtgaacgtcgaatgaatgaggagtacaagaacaacgagtgctac
tacctcatgtcattcgaccaaaacatgatcattgacgcaactaccggtagtatcgcgcgg
ttcgtcaatcattcatgctcccctaactgtcgcatgatcaaatggatcgtctctgggcag
ccgagaatggcgctttttgcgggtgaccgccccatccaaactggcgaggagctaacgtac
gactacaactttgaccccttctccgctaagaacgtgcagaagtgtttgtgcggtgcgccc
aactgccgaggcgtccttgggcccaaacccaaggaagtgaagccgcccaagcctccgaag
gcagagggtaagggcaagaaaaaggctgtgaaaaggaagcttcaagagctcctagccaat
agggtgattgtagagggcgatgaaaagtcaccgaagaaattgaaggtcgccaagtcgacc
gaagatacggcaaagggagctgcaacatttttgtcgcgaaaggtctctaaggtgtctgtt
agcgccaagtccaaggccgcttcggcaaagaccatcaagacattcgcccggaaggtcagc
attgcgtcgacgaaggttgtcaaatctttttcgaagggtgccgcggcgaagagcaagatg
atcacgctgaaagctccgacaaggggttctaacttgaccatagtcgcagctgattcaggc
ggctcgatcacagcggcaggaacgacggaggctgaggaggaggtaggaaacaaagcttcc
agggcagccagggcaactcccaagaacacgcccagggctaagaagacggcagacgctgtt
caggaaacgcctgctgctgcagaagatgacggcggctcagttttcgatgtaccgtcgtct
tcgtccgcgaggaaacgcgccccttcctggaaagtgcgcgactctggcgttaagaacgta
tcgtctctttttaagaaagcaaggaaatcaccagtcaagagcaaggacactgccagtcca
gcggccacgtctacggcagtcaccaaggtcgttaaaacgcgcaaggctagcacgtcggca
aaggtcacaaaaccgggcaaggcgatgccgaagctgactgtcgccatgaagacgggcaag
tccgtaaccaagaccacggcatcaaaatctggcaagggatcggtcagcactaagagtgcg
actaagattcgcctcgttagcaagccggccgatggccaggacgaaaatgccgctcccgag
caggtcgaggcctaa

DBGET integrated database retrieval system