KEGG   Sordaria macrospora: SMAC_05504Help
Entry
SMAC_05504        CDS       T01610                                 

Gene name
mak1
Definition
(RefSeq) MAK1 protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 471 aa AA seqDB search
MADLTGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNTQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPEMFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQALFPQANPDALDLLDRMLAFDPT
SRISVEEALKHPYLAIWHDASDEPDCPTTFNFDFEVVDDVGEMRKMILDEVYRFRQMVRT
VPGGHEQGGVQAHAPGQVPMPTDVHSQQWTAEDPRPHEYSGYNGGLEAELGGSKDYGMGF
LSGTLGREGHTNETLLIDTLRPQFLLGCRQPWEVVRRKGLNVRLGLISMFG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcacgggtcgcaagatcttcaaggtctttaaccaggacttcattgtcgac
gagcgctacaccgtcaccaaggagcttggacaaggtgcttatggcattgtctgcgccgcc
gtgaacacccagacgaacgagggagtcgccatcaagaaggtcaccaatgtcttcagcaaa
aagatcttggccaagcgcgccttgcgcgagatcaagctcctccagcacttcagaggccat
cgtaatattacctgcctctacgatatggatattcccaggccagaaatgttcaacgagacc
tatctctatgaggagttgatggaatgcgatcttgctgctatcatcaggtccggccagcca
cttacagacgctcacttccagtccttcatctaccagattctctgcggtctcaagtacatc
cactcggcgaacgtgcttcaccgtgatcttaagcctggtaacttgctcgttaatgccgac
tgcgagctcaagatttgcgatttcggtcttgcccgcggtttctccgttgatcccgaggag
aacgctggttacatgactgagtacgttgccacaagatggtatcgtgctcccgaaatcatg
ttgtccttccagaactataccaaagccatcgacgtatggtccgttggctgcattcttgcc
gagctcctcggcggccgtcccttcttcaagggcagagattacgtcgatcagctaaaccag
attctccacatcctcggcacacccaatgaggagaccctctcccgtatcggttcccccaga
gctcaagaatacgtccgcaacctgcctcccatgcccaagaagtccttccaggcactcttc
ccccaggccaaccccgacgccctcgatcttctcgaccgcatgctcgccttcgatcctacc
agccgcatcagcgttgaggaggctctcaagcacccataccttgccatctggcacgatgcc
agcgacgagcccgactgccctaccaccttcaacttcgactttgaggtcgttgatgatgtc
ggcgagatgcgcaagatgatcctcgatgaggtctataggttcaggcagatggtccggacc
gtgcccggtggtcacgagcagggtggtgttcaggcccatgctcccggtcaggtgcccatg
cctactgatgtgcacagccaacaatggactgctgaggatcctaggccacatgagtatagc
ggctacaacggtggcctggaggccgagcttggtggtagcaaagactatggcatggggttt
ctctcgggaaccttgggaagggaaggacacaccaacgagacacttctcatcgacacgctt
cgcccgcagttcttgttgggctgtcgacagccctgggaagtggtcaggaggaaaggcctc
aacgtcagactggggttgatctcaatgtttggttag

DBGET integrated database retrieval system