KEGG   Sordaria macrospora: SMAC_05504Help
Entry
SMAC_05504        CDS       T01610                                 

Gene name
putative mak1
Definition
(RefSeq) putative MAK1 protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 10806708
NCBI-ProteinID: XP_003349221
Position
Unknown
AA seq 413 aa AA seqDB search
MADLTGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNTQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPEMFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQALFPQANPDALDLLDRMLAFDPT
SRISVEEALKHPYLAIWHDASDEPDCPTTFNFDFEVVDDVGEMRKMILDEVYRFRQMVRT
VPGGHEQGGVQAHAPGQVPMPTDVHSQQWTAEDPRPHEYSGYNGGLEAELGGR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcacgggtcgcaagatcttcaaggtctttaaccaggacttcattgtcgac
gagcgctacaccgtcaccaaggagcttggacaaggtgcttatggcattgtctgcgccgcc
gtgaacacccagacgaacgagggagtcgccatcaagaaggtcaccaatgtcttcagcaaa
aagatcttggccaagcgcgccttgcgcgagatcaagctcctccagcacttcagaggccat
cgtaatattacctgcctctacgatatggatattcccaggccagaaatgttcaacgagacc
tatctctatgaggagttgatggaatgcgatcttgctgctatcatcaggtccggccagcca
cttacagacgctcacttccagtccttcatctaccagattctctgcggtctcaagtacatc
cactcggcgaacgtgcttcaccgtgatcttaagcctggtaacttgctcgttaatgccgac
tgcgagctcaagatttgcgatttcggtcttgcccgcggtttctccgttgatcccgaggag
aacgctggttacatgactgagtacgttgccacaagatggtatcgtgctcccgaaatcatg
ttgtccttccagaactataccaaagccatcgacgtatggtccgttggctgcattcttgcc
gagctcctcggcggccgtcccttcttcaagggcagagattacgtcgatcagctaaaccag
attctccacatcctcggcacacccaatgaggagaccctctcccgtatcggttcccccaga
gctcaagaatacgtccgcaacctgcctcccatgcccaagaagtccttccaggcactcttc
ccccaggccaaccccgacgccctcgatcttctcgaccgcatgctcgccttcgatcctacc
agccgcatcagcgttgaggaggctctcaagcacccataccttgccatctggcacgatgcc
agcgacgagcccgactgccctaccaccttcaacttcgactttgaggtcgttgatgatgtc
ggcgagatgcgcaagatgatcctcgatgaggtctataggttcaggcagatggtccggacc
gtgcccggtggtcacgagcagggtggtgttcaggcccatgctcccggtcaggtgcccatg
cctactgatgtgcacagccaacaatggactgctgaggatcctaggccacatgagtatagc
ggctacaacggtggcctggaggccgagcttggtggtaggtaa

DBGET integrated database retrieval system