KEGG   Sordaria macrospora: SMAC_05504Help
Entry
SMAC_05504        CDS       T01610                                 

Gene name
mak1
Definition
MAK1 protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
smp  Sordaria macrospora
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:smp00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SMAC_05504 (mak1)
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SMAC_05504 (mak1)
Protein kinases [BR:smp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SMAC_05504 (mak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 471 aa AA seqDB search
MADLTGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNTQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPEMFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQALFPQANPDALDLLDRMLAFDPT
SRISVEEALKHPYLAIWHDASDEPDCPTTFNFDFEVVDDVGEMRKMILDEVYRFRQMVRT
VPGGHEQGGVQAHAPGQVPMPTDVHSQQWTAEDPRPHEYSGYNGGLEAELGGSKDYGMGF
LSGTLGREGHTNETLLIDTLRPQFLLGCRQPWEVVRRKGLNVRLGLISMFG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcacgggtcgcaagatcttcaaggtctttaaccaggacttcattgtcgac
gagcgctacaccgtcaccaaggagcttggacaaggtgcttatggcattgtctgcgccgcc
gtgaacacccagacgaacgagggagtcgccatcaagaaggtcaccaatgtcttcagcaaa
aagatcttggccaagcgcgccttgcgcgagatcaagctcctccagcacttcagaggccat
cgtaatattacctgcctctacgatatggatattcccaggccagaaatgttcaacgagacc
tatctctatgaggagttgatggaatgcgatcttgctgctatcatcaggtccggccagcca
cttacagacgctcacttccagtccttcatctaccagattctctgcggtctcaagtacatc
cactcggcgaacgtgcttcaccgtgatcttaagcctggtaacttgctcgttaatgccgac
tgcgagctcaagatttgcgatttcggtcttgcccgcggtttctccgttgatcccgaggag
aacgctggttacatgactgagtacgttgccacaagatggtatcgtgctcccgaaatcatg
ttgtccttccagaactataccaaagccatcgacgtatggtccgttggctgcattcttgcc
gagctcctcggcggccgtcccttcttcaagggcagagattacgtcgatcagctaaaccag
attctccacatcctcggcacacccaatgaggagaccctctcccgtatcggttcccccaga
gctcaagaatacgtccgcaacctgcctcccatgcccaagaagtccttccaggcactcttc
ccccaggccaaccccgacgccctcgatcttctcgaccgcatgctcgccttcgatcctacc
agccgcatcagcgttgaggaggctctcaagcacccataccttgccatctggcacgatgcc
agcgacgagcccgactgccctaccaccttcaacttcgactttgaggtcgttgatgatgtc
ggcgagatgcgcaagatgatcctcgatgaggtctataggttcaggcagatggtccggacc
gtgcccggtggtcacgagcagggtggtgttcaggcccatgctcccggtcaggtgcccatg
cctactgatgtgcacagccaacaatggactgctgaggatcctaggccacatgagtatagc
ggctacaacggtggcctggaggccgagcttggtggtagcaaagactatggcatggggttt
ctctcgggaaccttgggaagggaaggacacaccaacgagacacttctcatcgacacgctt
cgcccgcagttcttgttgggctgtcgacagccctgggaagtggtcaggaggaaaggcctc
aacgtcagactggggttgatctcaatgtttggttag

DBGET integrated database retrieval system