KEGG   Sordaria macrospora: SMAC_05598Help
Entry
SMAC_05598        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
smp  Sordaria macrospora
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SMAC_05598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MAGLFGSAAASASNTLGDLKQDVELGQPPEDSITDLAFNPNPADQKDFLAVASWDKKTRI
YEILSNGQGQGQAMIEHDGPVFSCDFFKDGTKVISAGADKAAKVLDLATGQSMQVAAHDM
PIKCVRYFEANGTPMAVTGGWDKQIKYWDFRSANPAATVQAQERVYTMDVRDNLLVVGTA
DRYINVINLKDPGKFYKTMQSPLKWQTRVVSCFNDSQGFAIGSIEGRCAIQYVEDKDSAS
NFSFKCHRDPAQGNTTAVHAVNDISFHPQHGTFSTAGSDGTFHFWDKDAKHRLKGYPNVG
GSITSTTFNKTGSIFAYAISYDWSKGYQGNSPTYPNKVMLHPVQQDECKPRPSVKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcttttcggttccgccgccgcatcggcgagcaacaccctcggcgatctcaag
caggatgtcgagctcggccaaccccctgaggacagcattaccgatctcgccttcaacccc
aatcccgccgaccagaaggacttcctcgccgttgccagttgggacaagaagacacgcatc
tacgagatcttgagcaatgggcaaggccaggggcaggccatgattgagcatgatggtcct
gttttctcctgcgatttcttcaaggatggtacaaaggtcatctccgccggcgccgacaag
gccgccaaggttctcgatttggccaccggtcagtcaatgcaggtcgccgctcacgatatg
cccattaagtgtgttcgctacttcgaggccaacggcacccccatggcggtgacaggtggt
tgggacaagcaaatcaagtactgggacttccgctccgcgaaccctgccgctactgtgcag
gctcaggaacgtgtctataccatggatgtgcgcgacaacttgctcgtggtcggaaccgct
gatcgttacatcaacgtcatcaacctgaaggatcccggcaagttctacaagacgatgcag
agccctctcaaatggcagacccgcgtggtgagctgcttcaacgactctcagggttttgct
attggttcgatcgagggtagatgcgccattcaatacgtggaggataaggattctgcctcc
aacttctccttcaagtgccaccgcgatcccgcccaaggcaacaccaccgccgtccacgcg
gtcaacgacatctccttccacccccaacacggtacctttagcacagccggtagcgacggc
actttccacttctgggacaaggacgcgaagcaccgtctcaagggctaccccaacgtcggc
ggcagtatcacctcgacaacgttcaacaagaccggcagcatctttgcctacgccattagt
tatgactggagcaagggctaccaaggcaactctcccacgtacccgaacaaggtcatgctc
cacccagtacagcaagacgagtgcaagccccgccccagcgtcaagaagaggtag

DBGET integrated database retrieval system