KEGG   Sordaria macrospora: SMAC_05963Help
Entry
SMAC_05963        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
smp  Sordaria macrospora
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:smp04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1687 aa AA seqDB search
MAQALPIKFQELLQLSALGINQTAITFNTCTLESDNWVCIRDKKDEAASPEVIIVDLKNG
NNVIRRPIKADSAIMHWSRQVIALKAQARTLQIFDLENKAKLKSTNMSEDVLFWKWISET
TLGLITDGSVYHWDVFDPNQPAPVKVFDRNANLQGNQIINYRTSADGKWMVVVGISQQQG
RVVGAMQLYSKDRGISQAIEGHAAAFGTLRLEGAPEDTKVFTFAVRTAVGAKLHIVEVDH
PETNPVFPKKAVDVFFPPEASNDFPVAIQVSQKYGIIYLITKYGFIHLYDLETATCIFMN
RISSDTIFTACGDKDSTGVIGINRKGQVLFVSADENTIVPYVLEAHGNELAIKLASRAGL
PGADNLYQQRFEQLFSNGNYQEAAKVAANSPRGFLRTPQTIERFKRLPQQPGQMSHILQY
FGMLLDKGSLNEHETIELAMPVLAQNRKQLLQKWLSENKLECSERLGDMVRPHDINMALA
IYLKANAPHKVVAGFAETGQFEKILPYCSQANYQPDFIQLLQHIVRVNAEKGAEFATTLA
NHEGGPLVDFEKVVDIFQSQGMIQQATAFLLDALKDNKPEHGALQTRLLEMNLLNAPQVA
DAILGNDMFSHFDKAHIAQLCESAGLLQKALELYEDPAAVKRVIVNIPGMPNYNAEWLIE
YFKALSVEQSLDCLDAMMKHNIRQNLQTVVQIATKYAELLGAQQLIDLFEKYKTFEGLYY
FLASIVNVTEDPEVVFKYIEAATKMGQIREVERICRDNSVYNPEKVKNFLKEAKLTEMLP
LMVVCDRFNFVHDLVLYLYQNQQFKSIEIYVQQVNPSRTPGVIGGLLDVDCDESIIKNLL
STVNPASIPIDELVQEVETRNRLKLLLPFLEATLAAGNTQQAVYNALAKIYIDSNNNPEK
FLKENDQYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELVNITNENQMYKAQARYLLERAD
RELWMFVLSENNVHRRSVVDQVISTAVPESTDPAKVSEAVTCFLNADLPGELIELLEKIV
LEPSPFSDNQNLQNLLIFTAAKADKARVMDYIHRLDNFAADEIAAVCIEVGLHEEAFEVY
KKIDNKEAAVNVLVEHVVSIDRAQAYAEEVDIPQVWSKVAKAQLDGLRVSDSIDSYIKAE
DPKNYEEVIEIAVAAGKNEELIKYLRMARKTLREPVIDTALAFCYARLDQLPELEEFLRA
TNVANVEESGDKAYAEGFFEAAKIFYTSISNWAKLATTLVHLSDYQAAVDCARKANNIKV
WKEVHEACVNKKEFRLAQICGLNLIVDAEQLQALVKQYEANGYFDELISLLEQGLGLERA
HMGMFTELGIALSKYHPERLMEHLKLFWSRMNLPKMIRACEEANLWPELVFCYYHYDEFD
NAALAVMERPENSWEHQQFKEITVKVANLEIYYKAINFYLEQHPSLLTDLLQVLTPRIDV
NRVVRMFQKSDNLPLIKPFLLSVQSQNKRTVNDAINDLLIEEEDYKTLRDSVNNYDNYDA
VELAGRLEKHDLVFFRQIAANIYRKNKRWEKSINLSKQDKLWKDAIETAAISGKTEVVEE
LLRYFVDIGNRECYVGMLYACYDLIRADLVLELSWRNGLHDFTMPYMINMLCQQTKELAS
LKADNEARKAKEQEKEKVEDNTPILGNRLMITAGPGQASPAPYGQTNGLRRSLPDLASRG
LPWWQPR
NT seq 5064 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggccctccccatcaaattccaggagctgctgcagctcagcgcccttggcatc
aaccagaccgccatcaccttcaacacctgtaccctagaatcggataactgggtgtgtatc
cgcgacaagaaggacgaggccgcgtcccctgaagtcatcatcgtcgatctcaagaacggc
aacaatgttatccgacgtcccatcaaggccgacagtgccataatgcactggtcgcgccaa
gtaattgccctcaaggctcaagcgcgcaccctccagatcttcgacctcgaaaacaaggcc
aagctcaagtcgacaaacatgagcgaggatgtcttgttttggaagtggattagcgagacc
acgcttggtttgatcacagatggctctgtctaccactgggatgtcttcgacccgaaccag
cccgctccggtcaaggtcttcgatcgtaatgctaatctccagggcaaccaaataattaat
tatcggaccagcgccgacggaaagtggatggttgttgtcggtatctcacaacagcagggc
cgcgttgtcggcgctatgcagctttactccaaagaccgcggtatcagccaggccattgag
ggtcacgccgccgcttttggcactctccggctagagggcgctccagaggacaccaaggtg
tttacctttgcggtccgtaccgccgtcggcgcaaagcttcacattgtcgaggtcgaccac
cccgaaacaaaccccgtcttccccaagaaggccgtggacgtcttcttccctcccgaggcg
agcaatgacttccccgtcgccatccaggtttcgcaaaagtacggcatcatctaccttatc
accaagtacggcttcatccatctctacgacctcgaaaccgccacatgcatcttcatgaac
cgcatctccagcgataccattttcaccgcttgcggtgacaaggattcgaccggtgtcatt
ggcatcaaccgcaagggacaggttctcttcgtcagcgctgatgagaacacgatcgtgccc
tacgtcctcgaggcacacggtaacgagctcgcgatcaagctggcttctcgtgcagggctc
cccggtgccgataacctctaccagcaacgctttgagcagctcttcagcaatggtaactac
caggaggccgccaaggtagctgccaactctcctcggggtttccttcgcactcctcagacc
atcgagcgcttcaagcgtcttccccagcagcccggtcagatgtcgcatattctgcagtac
tttggcatgcttttggacaagggttcgttgaacgagcacgagactattgagcttgccatg
cccgtccttgcccagaaccgcaagcagctgttgcagaagtggctcagcgagaacaagctc
gagtgctccgagaggctcggtgacatggtccgccctcatgatatcaacatggcgcttgcc
atctacctgaaggccaacgctccccataaggtcgtcgctggattcgccgagaccggccag
tttgagaagatccttccctactgcagtcaagccaactaccagcctgacttcattcagctg
ctccagcatattgtccgtgttaatgccgagaaaggtgctgagttcgccacaacacttgcc
aatcacgagggtggtccgctggtcgattttgagaaggtggttgacatcttccagtctcag
ggaatgatccagcaagcgactgccttccttctcgacgctttgaaggataacaagcctgag
cacggtgcccttcagactcgcctgttggagatgaaccttctcaacgcccctcaggttgcc
gacgccattcttggcaacgacatgttctcccacttcgacaaggcgcacattgcgcagctc
tgtgagagcgcaggtcttttgcagaaggccctggagctctatgaggatcctgcggccgtc
aagcgggtgattgtcaacatccctggaatgcccaactacaacgctgagtggttgatcgag
tatttcaaggcgctgtctgttgaacagtcgcttgactgcctggacgccatgatgaagcac
aacattcgccagaaccttcagactgtcgttcagatcgcaaccaaatacgcggagctcctt
ggcgcacagcagctgattgacctgtttgagaagtacaagacctttgagggtctctactac
ttccttgccagcatcgtcaatgtcaccgaggaccctgaggttgtgttcaagtacattgag
gctgccaccaagatgggacaaatccgtgaggtcgaacgtatttgccgcgacaacagcgtc
tacaaccccgagaaggtgaagaacttcctcaaggaggccaagctcaccgagatgcttcct
ttgatggttgtctgcgatcgcttcaacttcgtccatgacctggttctctatctgtaccag
aaccagcagttcaagtccattgagatctacgtgcagcaggtcaacccgagcaggacccct
ggtgtcatcggaggcctcctcgatgtggactgcgatgaaagcatcatcaagaatctcctg
agcactgtcaaccccgcatctatccctatcgatgagctggtgcaggaggttgagactcgc
aaccgcctcaagcttctcttgcccttcctggaggctaccctggctgccggtaacacgcag
caggctgtctataacgctctcgccaagatctacattgactccaacaacaaccctgagaag
ttcctcaaggagaacgatcagtatgatactctcaccgtcggaaagtactgcgagaagcga
gatcccaaccttgcctacattgcctaccgcaagggccaaaatgatctcgagctcgtgaac
atcaccaacgagaaccagatgtataaggctcaggccaggtatcttttggagcgcgctgat
agggaactctggatgtttgtgctcagcgagaacaacgtccaccgtcgttctgtcgttgac
caagtcatctcgaccgctgttcctgagtcgactgatcccgccaaggtttctgaggctgtt
acatgcttccttaacgccgacttgcctggcgagctcatcgagttgctggagaagattgtc
ctggagccgtcacctttcagcgacaaccagaacctgcagaacttgctcatcttcactgct
gctaaggccgacaaggcgcgtgtgatggactacatccacaggctcgacaacttcgccgcc
gatgaaattgccgctgtctgtattgaggttggccttcacgaggaggctttcgaggtctac
aagaagatcgacaacaaggaggccgctgtcaatgttcttgttgagcacgttgtcagcatt
gaccgtgctcaggcatacgctgaggaggttgatattccccaggtttggagcaaggttgcc
aaggctcagctcgatggtctccgcgtcagcgattccattgactcctatatcaaggccgag
gacccgaagaactacgaggaggtgatcgaaatcgccgttgctgctgggaagaatgaagag
ctcatcaagtacctccgcatggcccgcaagaccctgcgcgagcctgttattgatacagct
cttgctttctgctacgcccgcctggatcagcttcctgagcttgaagagttccttcgcgct
accaacgttgccaacgtcgaggagtccggtgacaaggcgtacgctgagggcttctttgag
gcggccaagatcttctacaccagcatctccaactgggccaagcttgccaccacccttgtc
cacctttccgattaccaggcggctgtagattgcgcccgcaaggccaacaacatcaaggtc
tggaaggaggtccatgaggcctgcgtcaacaagaaggagttccgtctcgctcaaatttgc
ggtctcaacctcattgtcgatgccgagcaactccaggctcttgtcaagcagtacgaggca
aacggctactttgacgagcttatcagcttgctcgagcagggtcttggtttggagcgcgcc
cacatgggaatgttcaccgagttgggtattgctctctccaagtatcaccccgagcgtctt
atggagcacctcaagctcttctggagcagaatgaacctccccaagatgatccgcgcttgc
gaggaagctaacttgtggcctgagctggtcttctgctactaccactacgacgagtttgac
aatgctgctctcgccgttatggagcgccctgagaactcttgggagcaccagcaattcaag
gagatcactgtcaaggtggccaaccttgagatctactacaaggccatcaacttctacctg
gagcagcatccctctttgctcaccgaccttctccaggtattgaccccgcgcatcgatgtc
aaccgtgttgtccgcatgttccagaagtccgacaacttgcccctcatcaagcctttcctc
ctcagcgtccagtctcagaacaagcgtaccgttaacgacgccatcaacgatcttctcatt
gaggaggaggattacaagactctccgcgactctgtgaacaactatgacaactacgacgcc
gtggaacttgctggtcgtctggagaagcacgatcttgtcttcttccgccagattgctgca
aacatctaccgcaagaacaagcgctgggagaagtccatcaacctttccaagcaggataag
ctttggaaggatgcgattgagacggccgctatctctggcaagaccgaagtcgtcgaggag
cttctgcgctacttcgtcgacattggcaaccgcgagtgctacgttggcatgctttatgcc
tgctacgatcttatcagggccgaccttgtcctcgagctttcttggcgcaacggtctccat
gacttcaccatgccttacatgatcaacatgctttgccagcagaccaaggagcttgcttct
ctgaaggccgacaacgaggctcgcaaggctaaggagcaggagaaggagaaggtcgaggac
aacacgcccattcttggcaaccgactcatgatcactgccggtcccggccaggcatcaccg
gctccttacgggcagaccaatggtttgcgccgcagcctaccggatttggcttctagaggg
ctgccttggtggcagccccgttaa

DBGET integrated database retrieval system