KEGG   Sordaria macrospora: SMAC_05999Help
Entry
SMAC_05999        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
smp  Sordaria macrospora
Pathway
smp00600  Sphingolipid metabolism
smp01100  Metabolic pathways
Module
smp_M00094  Ceramide biosynthesis
smp_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMAC_05999
Enzymes [BR:smp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SMAC_05999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 10808694
NCBI-ProteinID: XP_003351120
UniProt: F7VTJ1
Position
Unknown
AA seq 512 aa AA seqDB search
MGDSHTHGSSNGADHHRVRRNTATSAVPSSGVTSTGSSAALPPQRRTVKREKSGNPKNMN
GPLYMQRNENIVLVRRVKRKGEGPMKQLTRWFVENQIGFAFNLLALLFLAHGCMPRARSH
TGKYFTLSYYNPTSGQYGLGKDDGFLIFFCIILFTGLRAATLEYLFAPYAKSKGISKRKD
ITRFSEQAWLLIYYSVFWTLGLYIYCQSPHFFNLRELWTNWPNRELTGLMKGYMLAQLAF
WLQQILVINIEERRKDHWQMFTHHIITICLIYASYRYGHTRVGNLILVLMDVVDLFLPLA
KCLKYLGHSTACDFMFVVFMVSWFIARHVLYMTVCYSVYAHTPSVMPYGCFTGSQGNLSG
PFQPPTDKGPLYLLEPLWKPDGLVCYDDTVKWTFLSMLLFLQALTIMWFSLIIRVAVRVL
KGEGADDTRSDDEGCGDDIDAEDDEEESAEYVYEETRALAEEVGVDELDLKNWVERRRGA
GGAGVTATGVSLPGHSDRKELLGRIGCEKQVE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattcccatacccacggctccagcaatggggccgaccatcaccgagtgagacgg
aataccgcgacatctgctgttccgtcctccggagtcaccagcaccggcagcagcgcagct
ctcccacctcagcggaggactgtcaaacgcgagaagtctggcaaccccaagaacatgaat
ggacccctctacatgcagcgcaacgaaaacatcgttcttgttcgtcgcgtcaagaggaag
ggcgagggccctatgaagcagttgacgcgctggttcgttgagaaccagatcggcttcgct
ttcaacctcctcgctctcctcttcctcgcccatggatgtatgcctcgcgcccgctcccac
accggaaagtactttacgctctcgtactacaacccgacgtccggacaatatggcctcggc
aaggatgacggctttctcattttcttctgcatcatcctctttaccggcctccgcgccgcc
actctggaatacctgttcgcgccgtacgcaaagtccaagggtatttccaagaggaaggac
atcaccaggtttagcgaacaggcttggctcctgatctactacagcgtcttctggactctc
ggtctctacatctactgccaatcaccgcactttttcaacctccgagagctctggacgaac
tggcccaaccgtgagcttaccggactcatgaagggatacatgcttgcccagctggccttt
tggctgcagcagattctggttatcaacattgaagagcgcagaaaggaccactggcagatg
ttcacccatcacatcatcaccatctgcctcatttacgcctcttacagatacggccacacc
cgcgttggtaaccttatcttggttctaatggatgttgtggacttgttccttccgctcgcc
aagtgcctcaaataccttggccactccaccgcctgcgacttcatgttcgtcgtcttcatg
gtctcgtggttcattgcccgccacgtcctgtacatgacggtctgctactcggtctacgcg
cacacgccctcggtcatgccgtacggctgcttcaccgggtcccaggggaacctttcgggt
cccttccagccgcccaccgacaagggccctctgtacctgctcgagccgctctggaaaccc
gacggactggtgtgctatgatgacacggtcaagtggaccttcctctcgatgctgctcttc
ctgcaagccctgaccatcatgtggttctcgctcatcatccgcgttgccgtgcgcgtactc
aagggcgaaggtgccgatgacacgcgcagcgatgatgagggctgcggggatgacattgac
gcggaggatgacgaggaggagtctgccgagtatgtctatgaggagactcgcgcgctggcg
gaggaggtcggcgttgatgagcttgatctcaagaactgggtggagagaagacgcggcgct
ggcggcgctggggtgacggccacgggcgtcagtctgcctggtcacagtgatcggaaggaa
ctgcttggtcggattgggtgtgagaagcaggttgagtga

DBGET integrated database retrieval system