KEGG   Sordaria macrospora: SMAC_06188Help
Entry
SMAC_06188        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
smp  Sordaria macrospora
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:smp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SMAC_06188
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SMAC_06188
Peptidases [BR:smp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SMAC_06188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1105 aa AA seqDB search
MLDHATSSHPVNGQNGHVIGGLDGTNDGGQGRIVNGGGGNGAGAGGSKRPPMPHIDDIKA
VTVSIDPATPIESALKLAEEALQQAKAFQSFGRIDMAFKSYIKANIIALDIIPKNRDWPV
LERTRPNVYMRHQHLLRQIKCLIQDFDKIKAQIKQDNARTGAQPLLGSPNQQKMPSVGNG
HTRSHSNFSSNTTSPNSSVYSSPQQRTNALPVQSGWASPGRSKPAVHPKPQALHGHTLQQ
FGGPAPPPTNNAAQDLALRFAKLRANTASTPSPTNTTAVQDPRIRTQPIPQPMMPINPPA
PRDPPRPQLPSVPPSAALADLPRVPAAIYNPPRGTVSNEAAELPSSAPRAMFSRKGSTAS
VSGMNRNGRPRTSDENLVSGPPVTSPKTRSKPTIPDGDTISAEELERYMRLGAREVSILV
IDIRSRDEYDDGHIMSQATICVENEVLLRPDISASQVAESMVLAPQAEQQHFERRHDFDM
IVFYDQQSKRLVSSPRTPEERAVLTFYNALTAYDYAGGSSSQQRLKLLRGGLEAWTDLVG
TGALQTSATSATARTQQRPPLAHNLTNRLRRNVTRPIQDLAEVQKWEENVDIVTPVRTTE
DFLRRYPSVSTIQESMTSPIHTSPARPASPLPRHIVHEQNLYSSLPSPPTRPAPTVPRRS
YSGLAETDTSTTATSKRSSLKSGIEKVRKFRTGLVNPGVFCFANSSLQAMFATPGFSREL
YTGVWKDVYKVPLKADEKNENPQLLTKYLAGLFHWLDEGTLRSLEAKHLMAYIHFIHSKN
ADGRKKPESEIFGGPAQQDAQEFYSFIIDNIHDETNIHRDRKPPKEEKPYTPKNGTVIQN
AIDYWRDYSTASASIIDKYFRGLEVFISRCQNAECRQEIRMFQPCDVWILNIAAETGGEG
NGYGATDLDRLLASHQATEHFADLKCETCNKPGRTRRAKFARLPDRLAFCLNRFNSSFGQ
SRSFTSMLSGSGGSNKIHTKVRFPIRDLDLTRYCAEPDPDMATTDDPHYAGRMKYDCYAV
TVHVGQGINGGHYYTYVQDEQSKDPTDWFKCNDDVVERVKIGSVSGSGGINGNGSNGGNI
PDLTEVMYANGNTSAYMVYYRRQGT
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcatgcaacatcttcgcatcccgtcaacggacagaatggccacgtaatagga
ggcttggacggcacaaatgatggtggacaaggcaggatagtcaacggagggggaggaaat
ggggcaggcgccggaggaagcaaacggccaccaatgccacacatcgacgacatcaaggct
gttacagtcagcatagaccccgcgaccccgattgaaagcgctctcaagcttgccgaggaa
gccctccagcaggccaaagccttccagtcctttggcaggattgacatggctttcaagtcc
tacataaaggccaacatcatagctctcgatatcataccgaagaatagggactggccggtg
ctggaacgaacccgaccgaacgtatacatgcgacaccaacatctcctccgccagatcaag
tgtctgattcaggactttgacaagatcaaagcacagatcaaacaggataacgccagaacg
ggtgcccagccgctattaggcagcccaaatcagcagaaaatgcccagtgttggaaacggt
catacgagatcacactcgaatttctcgtcaaataccacaagtcccaacagttcagtctac
agctcgcctcaacaacgtacgaatgccttgccagttcagtcaggatgggcctcgcctggg
aggtccaagccggccgtacaccccaaacctcaggctctccacgggcatacgcttcaacag
tttggaggtccagcgccgccacccaccaataatgctgcccaggacctcgctctacgcttt
gcaaaacttcgagcaaacaccgccagcaccccgagtccgaccaacacaacagcagtacag
gatccgcgaattcgaacacagcctattccacaacccatgatgccaataaatccaccggca
ccgcgtgacccaccgaggccacaattaccgagtgttcctccttcggctgccttagcagat
ttacctcgagtgccagctgctatctacaacccgccacgtggtacagtatccaatgaggca
gccgagcttccatcgagtgctcctcgtgccatgttttccaggaagggctccacggcatcg
gtctctggcatgaataggaacggcagaccccgtacgtccgatgaaaaccttgtttctgga
ccacccgtcacaagtccgaagacgagatcaaaacctactatacccgatggtgatactatt
tcggcggaggagcttgagcgttatatgagacttggtgctagggaagtgtccattctcgtg
attgatatcagaagtcgcgacgagtacgatgacgggcatatcatgtctcaagcaacaata
tgtgttgaaaatgaagtgctgctgagaccagatatttctgctagccaagtagcagagagc
atggtgttagcaccgcaagcagaacagcagcattttgaaagacggcatgatttcgatatg
attgttttctatgatcagcaatccaaacggctcgtatcaagtccgcggacaccagaggag
cgagcggtcctgactttttacaacgcacttacagcgtatgactatgcaggtggatcaagt
tcacaacaaaggctgaagttgcttagaggtggactggaggcatggactgacctggttggg
accggagcgttgcagacatccgccacaagtgccactgcgaggacacaacaaaggccgccc
ttagcccacaacctcaccaatcgactacgcagaaacgtaacgcggccgattcaagatctc
gcagaggttcaaaaatgggaagaaaacgttgacatcgttactccggtaaggacaacggaa
gattttctgcggaggtacccttcagtttcaacgatacaagagtccatgacttcacccatc
cacacttctcccgctcggccagcgagcccgttgcctcgacacattgtccacgaacagaat
ctttactcctcgctcccatctcctccaactcgcccggccccaactgtcccacgtaggagt
tatagcggtctagcagaaaccgataccagcaccacggcaacatcgaaaaggtcatcactc
aagtcaggaatcgaaaaggttcggaagtttaggactggtcttgtcaatcccggtgtgttc
tgcttcgccaacagctccctgcaagctatgtttgccacgcctggattttctcgcgagttg
tacacgggtgtttggaaggatgtgtacaaagttccactgaaagccgatgagaagaacgaa
aatccacagttactcaccaagtacctcgctggtctattccactggcttgacgaggggacg
ctgaggtcgttggaagcgaagcatctcatggcatatatccacttcattcactccaagaac
gcggatggcaggaagaagccagaaagcgaaatctttggtgggcctgcgcagcaagacgcc
caggagttctactcctttatcattgacaacatccatgacgagaccaacattcaccgagac
cgcaagccgcccaaagaagaaaagccttatacgcccaagaacgggacagtgatccagaac
gccattgattactggcgcgactactcaacagccagtgcatctatcatcgacaagtatttc
cgtggcctggaagtgttcatctcccgctgccaaaacgccgagtgccggcaagaaatccgc
atgttccagccctgcgacgtctggatcctcaacattgccgccgagacaggaggcgaaggc
aacggctacggcgccacagacctagaccgtcttcttgccagccaccaagcaaccgagcac
tttgcagatctcaagtgtgaaacatgcaacaaacccggcagaacaagacgggccaagttc
gctcgactaccggaccgtctcgccttctgcctcaaccgcttcaactcgtccttcggtcag
tcacgatcattcacctccatgctctccggcagcggtggctcgaataagatccacaccaaa
gtgcgcttcccgatccgcgacctcgatctgactagatactgtgccgagcctgacccggat
atggcgaccacggacgatccgcactacgccggccgcatgaagtacgattgctacgccgtc
acggtgcacgtgggtcagggcattaacggcggacattactatacgtacgtgcaggatgag
cagtccaaggacccgacggattggttcaagtgtaatgatgatgtggtggagagggtgaag
atcgggagtgtcagtggttcagggggcataaatgggaatgggagcaatggtggcaatata
ccggacctgacggaggtgatgtatgcgaacgggaacacgtcggcttatatggtttattac
cggaggcaggggacttga

DBGET integrated database retrieval system