KEGG   Sordaria macrospora: SMAC_06243Help
Entry
SMAC_06243        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
smp  Sordaria macrospora
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smp00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 450 aa AA seqDB search
MDGTIISTIISTINSTITITTTSTNHQGTGHVKMRTHALLLPGALLSSSFAAAATIPSPD
ANGKYWLNTTHLSLAFIPYGASITNLILADKHGKPLDIVAGYDNATAYTLDKAHPHFGSV
PGRYANRIKNSSFTLFSDSDPENGEKAAITYHVTPNENPTPENPHGVDTLHGGPDGWDYR
NFSVVAYTNSSITFSIVDPDGKEGFPGEVISYITYTVSGQTWDIKMVAIATTKKTPIMLS
SHTYWNLDGFELEDALGHELWMPLAGMRIGVDGILIPTGEVLANERGGVNDFWSKPKRIG
EAFGNGTEGSKKEGLEGNCGSGCTGYDNCYLNTLRPSPVSSLSDSWRSQPSQMVARLSSP
HSGIKLEVYSDQDAFQMYSCNQQKGDVPLKRTQGTDEIRTIPKYGCVVLEVQDWIDGINH
PEWGRTKKQVFGPGGDPYVLQARYVFGVDK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaccatcatcagcaccatcatcagcaccatcaacagcaccatcaccatcacc
acgaccagcaccaaccaccagggaaccggtcacgtcaagatgcgtactcacgctctgctc
ctacctggagcactactttcctcgtcctttgcagcggcagctacaatcccctcccccgat
gcaaacggcaaatactggctcaacaccacccacctctccctcgccttcatcccctacggc
gcctccatcaccaacctgatcctggccgacaagcacggcaaaccgctcgacatcgtagcc
ggctacgacaacgccacagcctacactctcgacaaggctcacccgcactttggttccgtg
cccggtcgctacgccaatcgcatcaagaacagctcctttactctcttttccgactctgac
cctgagaatggtgaaaaggcagcaataacataccacgtcacacccaacgaaaaccctacg
cccgaaaacccccacggcgtggataccctccacggcggtccggacgggtgggactaccgc
aacttttccgtcgtggcatataccaactcctccatcaccttctccatcgtcgaccccgac
ggcaaggaagggtttcccggtgaagttatttcttacatcacctacaccgtctcgggccaa
acgtgggatatcaagatggtggctatcgctactacaaaaaagacgccgattatgctgagt
agtcatacctattggaacttggacgggttcgagctcgaggacgcgctgggtcatgagctg
tggatgccgcttgcgggcatgaggattggtgtggatgggattctgattccgacgggcgag
gtgctggcgaatgagagggggggtgttaatgatttttggagtaaacctaaaaggattggg
gaggcgtttgggaatggcaccgagggaagcaaaaaggaagggttggaggggaattgtgga
agtgggtgcactggttatgataactgctacctcaacaccctccgcccctctccagtatcc
tccctctccgactcctggcgcagccaaccctcccaaatggtcgcccgcctctcttctccc
cattccggcatcaagctcgaagtctactcggaccaggacgccttccagatgtactcgtgc
aaccaacaaaagggcgacgtgcccctgaaacggacgcagggtacggacgagataaggacc
atccccaagtatggatgtgtagtccttgaagtgcaggattggatcgatgggatcaatcac
ccggagtgggggcggacgaagaagcaggtttttgggccgggaggggatccgtatgtgttg
caggctaggtatgtttttggggttgataagtaa

DBGET integrated database retrieval system