KEGG   Sordaria macrospora: SMAC_06304Help
Entry
SMAC_06304        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
smp  Sordaria macrospora
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SMAC_06304
  Lipid metabolism
   00062 Fatty acid elongation
    SMAC_06304
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     SMAC_06304
Lipid biosynthesis proteins [BR:smp01004]
 Fatty acid synthase
  Component type
   SMAC_06304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MAISKQLKLLFTSGSLIAAALASPVQKPLSSDDDIDDTPLPLVIWHGLGDSYSAPGLREV
GDLADAINPGTLVYFIRMDDDGSRDRSATFLGNVTEQVAKACADIAAHPILSTAPAIDAL
GFSQGGQFLRGYIERCNNPPVRNLVTFGSQHNGISAFRDCPWSDWVCRGAMAILKGNAWS
QFVQSRLVPAQYYRNPDEYEQYLEHSNFLADINNERKFKNQTYKENLANLENLVLYMFED
DTTVVPKETAWFDEVNGTEVTPLRARRMYSEDWIGLRELDKKGGLHFRTTPGDHMQLTDQ
LLNDTFAEFFGPLKKAKKSAPRPFLRGDL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccaagcagctgaagctgttgtttaccagcggctcgcttatcgcggccgcg
ctggccagtcccgtacagaagccgctcagcagcgacgacgacatcgacgacacaccactg
ccgctggtcatctggcatggcctaggagacagctactccgcccccggcctccgcgaagtc
ggcgacctcgccgacgccatcaaccccggcacgctcgtctactttatccgcatggacgat
gacgggtcccgcgaccgctccgccaccttcctaggcaacgtgaccgaacaagtggccaaa
gcctgcgccgacatcgccgcgcatccgattctctcgaccgcgcccgccatcgacgccctc
ggcttcagccaaggagggcagttcctgcgcggctacatcgaacggtgcaacaacccgccc
gtgcgcaacctcgtcaccttcggctcccaacacaacggcatcagcgccttccgcgactgc
ccctggtcggactgggtctgccgcggcgctatggctattctgaaaggcaacgcctggtcg
cagttcgtgcagagccggcttgttccagcacaatactaccgcaacccggacgagtacgag
caatatctggagcactccaactttttggcggatatcaacaacgagcggaagttcaagaac
cagacgtacaaggagaacttggccaatttggaaaacctggtgctgtacatgttcgaggac
gatacgacggtggtgcccaaggagacggcatggtttgacgaggtcaatggcactgaggtt
acgccccttcgcgcgaggaggatgtactcggaagactggattggcttgcgcgagttggac
aagaagggcggcttgcacttccgcaccacgccgggcgatcatatgcagcttacggatcag
ttgctgaacgacacgtttgccgagttctttgggccgttgaagaaggccaagaagagcgcc
ccgaggccgttcctgcgcggtgacctctga

DBGET integrated database retrieval system