KEGG   Sordaria macrospora: SMAC_06594Help
Entry
SMAC_06594        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smp  Sordaria macrospora
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SMAC_06594
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SMAC_06594
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SMAC_06594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 167 aa AA seqDB search
MSSATTFYDFKSLDKKGSELPLSTYQGKVVLVVNVASKCGFTPQYAGLESVYKEIKEKYP
NDFEILGFPCNQFGGQEPGTEEEISSFCQLNYGVSFPIMKKVEVNGDNATPVYEWMKNEK
PGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKDAILKELGE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgccactaccttttacgacttcaagtccctcgacaagaagggctccgaactc
ccgctctccacctaccaaggcaaagtcgtcctcgtcgtcaacgttgcctccaagtgcggc
ttcaccccgcaatacgcaggcctcgagagcgtctacaaggagatcaaggagaagtacccc
aacgactttgagatcctgggtttcccgtgcaaccagtttggcgggcaggagccgggaacc
gaggaggagatcagctcgttctgccagctcaactatggcgtctcgtttcccatcatgaag
aaggtcgaggtcaacggcgacaacgccacgcccgtgtacgagtggatgaagaacgagaag
cccggcctgatggggctgaagcgcatcaagtggaactttgagaagtttttgattggaaag
gatggcaaggttaagggaaggtgggcgagcacgactaagccggagagtctgaaggatgct
attcttaaggagttgggcgagtaa

DBGET integrated database retrieval system