KEGG   Sordaria macrospora: SMAC_06646Help
Entry
SMAC_06646        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
smp  Sordaria macrospora
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMAC_06646
Enzymes [BR:smp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SMAC_06646
Glycosyltransferases [BR:smp01003]
 Polysaccharide
  Storage polysaccharide
   SMAC_06646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 708 aa AA seqDB search
MAHDNREPREVKNHLLFEVATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEELEPTNPELKATIQAMRDRGIGILYGRWLIEGAPRVLLFDTKTAYGYLNEWKTDL
WNVASIPSPDNDEETKRLLSSVTWSHGSLARSFVCHEKKKAVIAHFHEWLAGVALPLTKR
RQIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCD
VFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQSKEKIHDFVRGHFY
GHYDFEPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKTAGSKTTVVAFIIMPAQTT
SLTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSLKWHEGDPLPDEKELITSQDRVLLR
RRLFAMKRHGLPPIVTHNMLNDHEDPILNQIRRVQLFNHPSDRVKIVFHPEFLSSANPVL
PLDYDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYG
IYIVDRRTKGVDDSVNQLTQYMFEFAQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKAR
QLALRRAYPTSFNGDEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQESHEGL
STEDYVAWKLPEEEDPEEYPFPLTLKQRTGPGSPLDGAIQGLQINGSK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgataaccgtgaaccccgcgaggtcaagaaccacctcctcttcgaggttgcg
accgaggtcgcccatcgagttggtggtatctactccgttatcaagtcgaaagcccccgtt
acaaccgctgaatatggcgaccgttatactcttatcggtcccctcaaccaccaatcggcg
gccgtcgaggttgaagaactggagcctaccaatcctgaactaaaggcgacgatccaggcc
atgagagatcgtggcattggcattctgtacggacgatggctcattgagggagctcctaga
gtgttgcttttcgatacaaagaccgcctacggttacttgaacgagtggaagacggacctc
tggaacgttgcttccatcccatccccggacaacgacgaagagacgaagaggctattgtct
tcggttacctggtcgcatggttccttggcgaggtcattcgtgtgccacgagaagaagaag
gctgttattgcccacttccacgaatggcttgccggtgttgcgctgccattgaccaagagg
aggcagattgacgttacgactatcttcacgacacatgccactcttctcggtcgctacttg
tgcgcaggctctgtggacttctataacaaccttcagtggttcgatgttgatgctgaggct
ggaaagcgcggtatctatcacagatactgcatcgagcgagctgccgcccattcttgcgat
gtcttcaccaccgtttcccacatcaccgcctacgagagtgagcatttgctcaagcgcaag
cccgatggtgtcctccccaacggtctcaacgtcaccaagttctcggccatgcatgagttc
cagaacctccatcagcagtccaaggaaaagatccacgactttgtccgcggtcacttttat
ggccattacgatttcgagccagaaaacaccctctacttcttcactgccggtcgctacgag
ttcaggaataagggtgtggatatgttcattgagtcgcttgcccgtcttaaccaccgcctg
aagaccgccggaagcaagaccacggttgttgctttcatcatcatgcctgcccagaccact
tccttgactgttgaagcattgaaggggcaggccgtcatcaagtctctgagagacaccgtc
gatgttatcgagcgtggcattggccgccgcatcttcgagcgctctctcaagtggcacgag
ggcgacccgttgcctgatgagaaggagctgatcaccagccaggaccgtgtcctccttcgt
cgtcgtctcttcgccatgaagaggcatgggctcccgcccattgttacccacaacatgctc
aacgaccatgaagacccgattctgaaccagatccgccgggtacaactcttcaaccatccc
tcggaccgcgtcaagattgttttccatcccgagttcttgagctcggccaaccccgtgttg
cctcttgactacgatgactttgtgcgcggcacccatttgggtgtcttctcttcttactat
gagccttggggttacactccggcagaatgcacggttatgggtgtaccaagcatcaccacc
aacctttctggatttggctgctacatggaggagctcattgagaactcgagcgactacggt
atctatatcgtggaccgtcgcaccaagggcgtcgatgactcagtcaaccagcttactcag
tacatgtttgagtttgcccagaagagccgcagacagcgtatcaaccagagaaacagaacc
gagcgtttgagcgatctcttggactggaagcgcatgggcatggagtacgtcaaggcccgc
caactcgcgttgcgccgcgcctatcccacgtctttcaatggcgacgaggaggaagacttc
atcccaggagtcgagcagaagatttctcgtcccttctcagtgccgggctcacctagagac
cggactggtatgatgacccctggcgatttcgctagtcttcaggaaagtcatgagggtttg
agtaccgaggattacgttgcgtggaagctacctgaggaagaggaccccgaagagtaccct
ttcccgcttaccctcaagcagcgcacggggccgggtagccctctcgatggtgctatccaa
ggcctgcaaatcaacggcagcaagtaa

DBGET integrated database retrieval system