KEGG   Sordaria macrospora: SMAC_06686Help
Entry
SMAC_06686        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
smp  Sordaria macrospora
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SMAC_06686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1797 aa AA seqDB search
MAELRKFESLYALHTELQAVSQQRYEELQTVEQLLEQHADSFSKFLDKPARNATHRTNLQ
SGKVKVEDQEYAVTQNFINDALKLADELDLDEIEAARVLLDADAEGDQASFDRPLWVCGL
IRFQNERSYLLDCMRLCIQIANDEDIDPSVQEGFGQVVDERIFGIPAQGSKAQAGAQKIV
PKCVAGLQGIRSTMQNIGEKVAAQNVLFHPNVSKRMDQQEPSEIMRLKLIEQHETLALIL
CAAIEKKQAESKDFNEFIQLLRKVDKYDHLLVHLIAVLGAYIAIFGSNVGGGDVEPVRQL
NEFICGRTAEDVWAIPSLGAAVRAWWIAEYSGWYHDDYAGYEARGINLDKEDEERTKQFM
DALKDGAFDFLLAVAADCHAHNQDWQDPTRWGMRQWLQRKALPLASEALPFAPHFHSTLM
THLEVLIDAAISNIPDVLRKLRTEEDEQRQLSQTHEQDLDLERFLMIIAYAYDGRPDAAM
TFWEDAESNLSGFLNWASRRASTPLVSAFCEMLQALSGNEECATAAHNFLLDETTHSGGK
LKRSASLTWNQIFKELKFFMEKLQTKPLPAQSQLVRHHAKPSSDQAETEPESAMMLECYL
RLIAKLGYESPVARGLLLLDTSVELPETLIRLASAQIPGRLRACVFNAFRALMHGKTHQE
SEIMWDFIDLWLVGGWGPKADPQRTVAMLQPSPQAVMDAILDDISDGFEQPVAFIQLLIS
LIQPSVDDGELCDKLPFKEALGTSNRLSGVDVYVDYVFGLVLTKKARDITDPMQLRILQL
SCLEFALASLASFNEDLIVLGNESNVNVDLAMPTSSLEAYVRLHPFARVMEWMFNEKVVN
ILVDIINRDADVLGQSSHDSPVVMGVLRAVQVMIKVIELQDTYLDLVRPLIKKQLGQRSR
SVASGAYSAFEDGIMNHLSLVEDLGRFTNLGNPDLTWASLKLLEKISTSSKIISAWNPDG
RHAHRNKAIVQLERGGAGVSIAASLANTIAQTLDPVQEAESPGYRTKMFILDFLYKCLKA
NPDKPTIAHLLLGFRCEINGLAIEHNGAFDMQRSLFHSLLNAFIGLSVYQEELGMRGYLI
TLKRKVLRIFQILWSSPLSSKLVMEELRATNFLFHSLLQEPQVQPHLRWDGAEAVSPEFL
VTDASHSYIEFLATRAMAFEYIAKELCSVSQKRIPTVKRQIFDALNGQIRVDDDEPINIA
NIFDFFDFLNIDFVNIPSPEFDIYRDIDLTPCVEEDAITGSQFDIHKVHQLALLKRAERL
NRDNPEKKDTRALIAQDELAAWDREQSLLLEYVVYHNRQKQFSAHRLKVLRAWTNILLVM
FEANDFKGTPKMAFLLQALQAILPSLEAFSTLSPAEAFELARVAKVLLFKLDLSDSNGDG
VTDKDIGNLISDKLFQLFQVCLTSIASWVGSADLRAIYYSICYRYLTSVVDKTTDHTGAT
TSNALATARSRAIKAIQAYGDRLLNVICDDAYGSDSTCQTAAMILLGALVHLDHTTTVSG
LQHTNNLDGSFVINTLNRLNFIGVLVDSLKTILQDWSAVASSSSSSQSQPQPQPSSAHLH
HQQQLALPTQHQSATDSQYLLSKLSLLLALCRSKLGSKFVLQANLFRALEVSGVFSTDPE
LLVRQQQQQQSSSSATGSSTTETNTVRAMERHYTLLVYLARIVSAAVMAGKKRGSHNALQ
GRKFLQAARGLVVQVLKRSVGIGAGAVGGAGSGSGQGNAGNGGVSMRAVNGSAYGSTVTN
GGDNKQGSEVQLELELEERVDELAEAFMLLIQATGFLEFEEEQMPAEKKPKGDLLFH
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactacgcaaattcgaatccctctacgccctccacaccgagcttcaggccgtc
agccaacagcgctatgaggagctccagaccgtcgaacagctgctcgagcagcacgccgat
tccttcagcaaattcctagacaagccggcccgcaacgccacccacaggacgaacctgcag
agcggcaaggtcaaggttgaggaccaggaatatgccgtcacccagaacttcatcaatgac
gcccttaagcttgccgatgagctcgatctcgacgaaatcgaggccgcccgcgttctcctc
gatgccgatgccgagggcgaccaggccagcttcgaccgtcccttgtgggtgtgcggcctc
atccgcttccagaacgaacggagctacctgctcgactgtatgcgcctctgcatccagata
gcaaacgacgaggatatcgacccctccgtgcaggaaggctttggtcaggttgtcgacgag
aggatctttggcattcccgctcagggtagcaaggcccaggctggtgcccagaagatcgtg
cccaagtgcgtggccggactccaaggcatcaggtcgaccatgcaaaatatcggggagaag
gtggcagctcaaaatgtcctgtttcaccccaacgtctccaagcggatggaccagcaagaa
ccgtccgagatcatgcgcctcaagctaatagagcagcacgaaaccttggccctcatactg
tgtgccgccatcgagaagaaacaggccgagtccaaggacttcaacgagtttatccagctt
ctgaggaaagtagacaaatacgaccacctactagtacatctcatcgcggtactcggcgcc
tacatcgccatctttggctccaacgtgggtggtggggacgttgagccggtgcgacagctg
aacgagttcatctgtggaaggacggccgaggatgtctgggcgataccgagtctcggcgct
gcggtgcgtgcatggtggattgccgagtatagcggctggtatcatgacgattacgccggc
tacgaggcccggggcatcaacctggacaaggaggacgaggaaaggacaaaacagttcatg
gatgccctgaaagatggcgccttcgacttccttctcgccgtggccgccgattgccatgcg
cacaaccaggactggcaggaccctacgcgctggggaatgcgtcagtggttgcagcgcaag
gctctgcctctggcatccgaagccctccccttcgcgccccattttcactctactctgatg
acccacctcgaggtcctcatcgatgctgccatctctaatatcccagacgttctgcgtaag
ttgaggaccgaggaggatgagcagcgccagttgagccaaacacacgagcaggaccttgat
ctggaacggttcctcatgatcattgcctacgcctacgatggccgacccgatgcagccatg
accttctgggaagatgctgaaagcaacctctccggctttttgaattgggcgtcgaggaga
gcttctacccctctggtcagcgcattctgcgagatgctccaagctctttccggtaatgaa
gaatgcgcaacggcggcccacaacttcttgctcgacgaaaccactcactcgggaggcaag
ttgaaacggtcagcgtccctgacttggaaccagattttcaaggaactcaagttcttcatg
gagaagctccagaccaagccgcttccagcccagtctcagcttgtccgtcatcacgcaaag
cccagcagcgaccaagccgagactgagcctgaatctgccatgatgctggagtgctacctg
cgtctcattgctaaactcggctatgagagcccagtagccagaggtctcctgcttctcgac
acaagcgttgagctgcccgaaaccctaattagactggccagtgcgcagattcccggccgt
ctccgagcctgtgtcttcaacgcattccgagcccttatgcatggcaagacgcatcaggag
tcggaaatcatgtgggactttatcgacctttggttggtgggaggttggggccccaaggcc
gacccgcaacgaaccgtggccatgctgcagcccagtccccaggccgtgatggatgctatt
ctcgatgacatcagtgatggatttgagcagcccgttgccttcatccagctgctcatttct
cttatccagccatcggttgatgacggagagctttgcgacaagctgcctttcaaggaggcg
cttggcaccagtaaccgactgtccggtgttgatgtctatgtggactatgtctttggtctc
gtgttgaccaagaaggctagagatatcactgaccctatgcagctgaggatcctacagctc
agctgcctcgagtttgccctggcttccctggcatcgttcaacgaagacctcatcgtcctg
ggcaacgagagcaacgttaatgttgatctcgcaatgcctacctcaagtctggaagcctac
gtgcgcttgcatccgttcgcccgggttatggagtggatgttcaacgaaaaggttgtgaac
attcttgttgacatcatcaacagagacgcggatgtccttggacagtcgtcccacgattcc
cctgttgttatgggtgtcttgcgagccgtccaggtcatgatcaaggtcattgagctacag
gacacttatcttgatctcgtccgccctcttattaagaagcagcttggacagcgaagccgc
tctgtcgcaagtggtgcttattccgcttttgaggatggcatcatgaaccatctgtctctc
gtggaggatctcggccggttcaccaaccttggaaatcctgatctcacctgggcctccctc
aagctcttggagaagatctcgacatcctccaagatcatctcagcctggaaccccgatggt
cggcacgcgcatcgcaacaaggctattgtccagctcgagagaggtggtgcaggtgtatca
atcgccgcatccttggccaacaccatcgcccagacgctcgaccccgtccaggaggccgaa
tcgcctggttaccggaccaagatgttcatcctcgatttcctctacaagtgtctcaaagcc
aaccccgacaaacccaccattgctcatttgctcctcggcttccgttgtgagatcaacggg
cttgccattgaacacaatggcgcctttgacatgcagcgatcgctattccatagccttttg
aacgctttcattggcctgtcagtctaccaagaggagttgggcatgcgcggctatctgatc
actctcaagcggaaggtccttcgcatcttccagatcctgtggagttctcccctttcttcg
aagttggtcatggaagagttgcgagctactaacttcctcttccactccttacttcaagaa
ccacaagtccagccacatctcaggtgggacggcgctgaagcggtttcccccgaattcctg
gttaccgacgcatcgcattcctacattgagttccttgcgacgcgtgccatggcttttgaa
tacatcgccaaggagctttgcagtgtctcccagaagcggatacccaccgtcaagcgtcaa
atctttgatgcgctgaacggacagatccgggtcgatgacgatgagcctatcaacattgct
aacatctttgatttctttgacttcctcaacatcgactttgtgaatatcccctcgcccgag
tttgacatttacagggacatcgacctcaccccatgcgtcgaggaggacgcgatcaccggc
tcacagtttgacatccacaaagtccaccagctggctttgctcaagcgcgctgagaggctc
aaccgggacaatccggagaagaaggatacccgggccttgatcgcgcaagacgagctggca
gcttgggaccgcgagcagagcctcttgctcgaatatgtcgtctaccacaaccgccagaag
cagttcagcgcccaccggcttaaggtgctccgggcatggactaacatcctgctggtcatg
ttcgaggccaacgacttcaagggcacgcccaagatggccttcctcctccaagcgctgcaa
gccattctccccagcctcgaagccttcagcaccctcagccccgccgaggcctttgagctc
gcccgcgtggccaaggtgctgctcttcaagctcgacctctcggacagcaacggcgacggc
gtcaccgacaaggacatcggcaacctcatcagcgataagctcttccagctgttccaggtg
tgcctcacctccatcgccagctgggttggcagcgccgacctgcgcgccatctactactcc
atttgctaccgttacctcacctcggtagtcgacaagaccacggaccacaccggcgccacg
accagcaacgccctggccaccgcccgctcccgcgccatcaaggccatccaagcctacggc
gaccgtctcctcaacgtcatctgcgacgacgcctacggctccgactcgacgtgccaaacc
gccgccatgattttgttaggtgccctcgtccaccttgaccacaccaccacggtctccggt
ctgcagcacaccaacaacctcgacggttccttcgtcatcaacaccctcaaccgtctcaac
ttcatcggcgtcctcgtcgactccctcaagaccattctgcaggattggtccgccgtcgcc
tcctcttcttcctcttcacaatcccaaccgcaaccccaaccctcctccgcccaccttcac
catcaacaacaactcgccctccccacccaacatcaatccgcaacagacagccaatacctc
ctctccaaactctccctcctcctcgccctctgccgctccaagctcggctccaagttcgtc
ctgcaagcgaacctcttccgcgccctcgaagtatccggtgtattttctaccgatcccgaa
cttttagttcgccagcagcagcaacaacaatcctcttcttctgctaccggctcctcgaca
accgagaccaacaccgttcgcgccatggaaagacattacacccttttggtctacctcgca
aggattgtcagtgcggcggtcatggccggcaagaaacgcggaagccataatgcgttgcag
ggacgcaagtttttgcaggcggcgagggggttggtggtgcaggttttgaagaggagtgtg
gggatcggtgctggtgctgttggtggtgctggttctggttctggtcagggtaacgctgga
aatggtggtgtttcgatgagggctgtcaatgggagtgcttacggaagcactgttaccaat
ggtggggataacaagcaggggagtgaagtccaactggaactggagctggaagagcgggtg
gatgagctcgccgaggcgttcatgttgttgattcaggctacggggtttttggagttcgaa
gaagagcaaatgcctgctgagaagaagcccaagggggatttactctttcattaa

DBGET integrated database retrieval system