KEGG   Sordaria macrospora: SMAC_06760Help
Entry
SMAC_06760        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K10756  
replication factor C subunit 3/5
Organism
smp  Sordaria macrospora
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:smp03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:smp03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:smp03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MALIVDKHRPRSLDALTYHPELSERLRSLAQSGDFPHLLVYGPSGAGKKTRIVATLKELY
GPGVEKIKIDARVFQTSNNRKLEFNIVASVYHLEITPSDVGNYDRVVVQDLLKEVAQTQQ
VDQSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNLRLILLANSTANIIAPIRSRCL
LVRVAAPTHQEICDVLASSAKKEGWPVVQGLHQRIAEESGRNLRRALLMYEAVHAQNEKV
TDTTPIPPPDWEALIGQIAKEIMEEHTPARILQVRAKLYDLLTHCIPATSILKTLTFKLI
PLIDDALKADVIYWSAFYEHRIKTGTKVIFHLEAFVAKFMRIFEMYLMSMDL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttatcgtcgacaagcacaggccgaggtctctcgatgccctcacatatcatccc
gaattgtcggagaggctacggtcactcgcgcaaagcggtgacttcccccacctcctcgtc
tacggtccatccggcgcaggaaagaagacccgaattgttgctaccctcaaggagttgtac
ggccccggtgtagagaagatcaagatcgacgcccgtgtcttccaaaccagcaacaaccgc
aagctcgagttcaacattgtcgcatcagtgtaccacctcgaaatcactccgtccgatgtc
ggcaactatgatcgagtagtagtccaggacctcctcaaggaggtggcgcaaacacaacaa
gtcgaccagtcagcaaagcagaggttcaaggtggtggtcatcaacgaggccgaccacctc
accagagacgcccaggctgccctccgtcgcaccatggagaagtactcgcccaacctacgt
cttatcctcctcgccaactcgacagccaacattattgcacccattcgatcgcgatgcctg
ctcgtgcgggtagcggctccgacacatcaagagatctgcgatgtccttgcttcgtcagcg
aagaaggagggctggccggttgtccagggtctacaccagaggatagccgaggaaagcgga
aggaatcttcgcagagcactgttgatgtacgaggcggtacatgcgcaaaatgagaaagtc
acagacaccactcccataccacccccagactgggaagccctcatcggacaaattgccaag
gagatcatggaggagcacacaccagcacgaatcctgcaagttcgagccaagctttatgac
ctcttgacacactgtattcccgcgacgagcatcctaaagacgctcacattcaagctcatc
cctctgatcgacgacgcactcaaggcggatgtgatctactggtccgccttttacgaacat
cgcatcaagacgggtaccaaggtcatcttccacttggaggcgtttgtggccaagttcatg
aggatattcgagatgtatctgatgagcatggacttgtaa

DBGET integrated database retrieval system