KEGG   Sordaria macrospora: SMAC_06760Help
Entry
SMAC_06760        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K10756  
replication factor C subunit 3/5
Organism
smp  Sordaria macrospora
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SMAC_06760
   03420 Nucleotide excision repair
    SMAC_06760
   03430 Mismatch repair
    SMAC_06760
DNA replication proteins [BR:smp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    SMAC_06760
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     SMAC_06760
Chromosome [BR:smp03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    SMAC_06760
DNA repair and recombination proteins [BR:smp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    RFC (replication factor C)
     SMAC_06760
  Check point factors
   HRAD17(Rad24)-RFC complex
    SMAC_06760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MALIVDKHRPRSLDALTYHPELSERLRSLAQSGDFPHLLVYGPSGAGKKTRIVATLKELY
GPGVEKIKIDARVFQTSNNRKLEFNIVASVYHLEITPSDVGNYDRVVVQDLLKEVAQTQQ
VDQSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNLRLILLANSTANIIAPIRSRCL
LVRVAAPTHQEICDVLASSAKKEGWPVVQGLHQRIAEESGRNLRRALLMYEAVHAQNEKV
TDTTPIPPPDWEALIGQIAKEIMEEHTPARILQVRAKLYDLLTHCIPATSILKTLTFKLI
PLIDDALKADVIYWSAFYEHRIKTGTKVIFHLEAFVAKFMRIFEMYLMSMDL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttatcgtcgacaagcacaggccgaggtctctcgatgccctcacatatcatccc
gaattgtcggagaggctacggtcactcgcgcaaagcggtgacttcccccacctcctcgtc
tacggtccatccggcgcaggaaagaagacccgaattgttgctaccctcaaggagttgtac
ggccccggtgtagagaagatcaagatcgacgcccgtgtcttccaaaccagcaacaaccgc
aagctcgagttcaacattgtcgcatcagtgtaccacctcgaaatcactccgtccgatgtc
ggcaactatgatcgagtagtagtccaggacctcctcaaggaggtggcgcaaacacaacaa
gtcgaccagtcagcaaagcagaggttcaaggtggtggtcatcaacgaggccgaccacctc
accagagacgcccaggctgccctccgtcgcaccatggagaagtactcgcccaacctacgt
cttatcctcctcgccaactcgacagccaacattattgcacccattcgatcgcgatgcctg
ctcgtgcgggtagcggctccgacacatcaagagatctgcgatgtccttgcttcgtcagcg
aagaaggagggctggccggttgtccagggtctacaccagaggatagccgaggaaagcgga
aggaatcttcgcagagcactgttgatgtacgaggcggtacatgcgcaaaatgagaaagtc
acagacaccactcccataccacccccagactgggaagccctcatcggacaaattgccaag
gagatcatggaggagcacacaccagcacgaatcctgcaagttcgagccaagctttatgac
ctcttgacacactgtattcccgcgacgagcatcctaaagacgctcacattcaagctcatc
cctctgatcgacgacgcactcaaggcggatgtgatctactggtccgccttttacgaacat
cgcatcaagacgggtaccaaggtcatcttccacttggaggcgtttgtggccaagttcatg
aggatattcgagatgtatctgatgagcatggacttgtaa

DBGET integrated database retrieval system