KEGG   Sordaria macrospora: SMAC_06800Help
Entry
SMAC_06800        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SMAC_06800
Peptidases [BR:smp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SMAC_06800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MSTISVVVKHQGKKYDVDVDTSATGEVFKYQLYSLTGVEPDRQKVLLKGSQLKDDTDMSK
VGLKPGQMIMMMGTPGEGGGAIARPTEKVKFIEDMTEAEAAQQAGATPAGLQNYGNTCYL
NSTLQVLRSIPELSDALKSYKGEQSMSDPTTQLRNLYDMMSKTQEGIPPLGFLHALRVTY
PPLKQKLKIPEGDAAKDASFIDKYMGLELTSVLECDEPGAKEAGEEPKTTKDRLLKLNCH
IDGQTNHLRDGIVNGLVEKLEKKSEVLDREATYTKRSQISRLPKYLTVHFMRFFWKREVQ
KKAKIMRKVTFPFELDVVEFCTDDLRKALIPVRDKVREVRKEEHDIERARKRRKMNPIDG
ENAQGSTPSSSSKDKKKDEKKPSGGDVEMTTEETFKTDAEFEAEKEAEVLAAKKELYSLI
NQDLLKDEGANQSGLYELRGVITHQGASADSGHYTAYVKKTGIKDPVTGKIGEEDGKWWW
FNDDKVSEVEAEKITALAGGGESHSALVLLYRAIPLPSADGTQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactattagcgtggtggtgaaacaccaaggaaagaaatacgacgtcgatgtcgat
acctccgcgaccggtgaagtcttcaagtaccagctctacagtctgactggtgtcgagccc
gaccggcaaaaggtgctcctcaagggcagtcaactcaaagatgataccgatatgagcaag
gtgggcctgaagcccggccagatgatcatgatgatgggaaccccaggtgagggtggaggt
gcaatcgctcgaccaaccgagaaagtcaagttcatcgaggacatgaccgaggccgaagcg
gcacaacaagcgggagcgactccggccggtctccagaattacggcaacacctgctacctc
aactcgacactccaagtcctccgctccatccccgagcttagcgacgctctcaagtcctac
aagggtgaacagtccatgtcggatcctacgacgcagctcaggaatctctacgatatgatg
tcgaaaacacaagaaggcattcctccgctcggttttctgcatgctcttcgtgtcacttac
cccccactcaagcaaaagctcaagattcccgagggtgacgccgccaaagacgcatccttc
atcgacaagtacatgggcctcgaactcaccagcgttctcgagtgcgatgaacctggcgcc
aaggaggccggcgaggaaccaaagacaacaaaggaccgtctccttaagctcaactgccat
atcgacggtcagaccaatcatctcagggatggaatcgttaacggtttggtggagaagctc
gagaagaagtcggaggttctggatagggaagcgacatacactaagcgttcccagatctca
cggctacccaagtatctgaccgtgcacttcatgcggttcttctggaagcgtgaggttcag
aagaaggccaagattatgcgcaaggttactttcccattcgagcttgatgtggtcgagttc
tgcacggatgaccttaggaaggctctcattcctgtcagggacaaggtccgcgaggtgcgc
aaggaggagcacgatattgaaagggcacgcaagcgcagaaagatgaaccctattgacggc
gagaacgctcaaggatccacgccatcatcatcatccaaggacaagaagaaggacgagaag
aagccttctggcggtgacgtggagatgaccacagaggagaccttcaagaccgacgctgag
tttgaggccgagaaggaagctgaggtgctcgctgccaagaaggagctctactccttgatc
aaccaggatctgctcaaggacgaaggtgccaaccagtctggcttgtatgaacttcgcggt
gtcatcacccatcagggtgccagcgccgacagcggacattacacggcctacgtcaagaag
acggggatcaaggaccccgtcactggcaagatcggtgaggaggacggcaagtggtggtgg
ttcaacgatgacaaggtttctgaggtggaggcggaaaagatcactgctctggctggtggt
ggagagtcgcactcggccttggtcttgctctaccgcgcgattcctcttcccagtgccgac
ggaacccagtaa

DBGET integrated database retrieval system