KEGG   Sordaria macrospora: SMAC_06805Help
Entry
SMAC_06805        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
smp  Sordaria macrospora
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:smp00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1145 aa AA seqDB search
MARSGKKSPAPPPAYAPAYAPPPAYEAVPTSAVVFKTKNNKNKSVKVKDDYSSDGVQDND
PFLLPGSDFTLLTITTIVSAIVRLFRIYQPSSVVFDEVHFGGFASKYIKGKFFMDVHPPL
AKLMITLFGWLAGFDGNFDFKEIGKDYIEPGVPYVAMRMFPAICGILLAPTMFLTLKAAG
CRSTTAFLGAGLIIFENGLLTQARLILLDSPLMIGTALTALGFTAFTNQQELGPAKAFTP
SWWFWLAITGLGLGITASIKWVGLFTIAWVGSLTLIQLWVVLGDYKHVSPRAFTKHFMAR
AFCLIVIPLSFYLAMFGIHFLCLTNPGEGDGFMSSEFQSTLNSKGMQDVPADILMGSRVT
IRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDDNNIWLLENQTQPLGIDGQPINGTSA
WNNLPETPYIKDGAILRLYHLPTHRRLHSHDVRPPVTEADWQNEVSAYGYEGFDGDANDF
FRVEIVKKKSKGGVAQERLRTIDTKFKLVHIMTGCVLFSHKVKLPDWASEQQEVTCAKGG
SLPNSLWYIESNDHPQLGADAEKVNYRNPGFFGKFWELQKVMWKTNAGLVESHAWDSRPE
AWPILRRGINFWGRQHRQVYLMGNPIIWWSATAAVVLYVLFKGIAILRWQRSCNDYANPI
FKRFDYEVGTSVLGWALHYFPFYLMQRQLFLHHYFPALYFAIIAFCQVFDFLTARISLVK
DKVIFNRLGAVLFLALSMVVFWLFSPLAYGNPWTKAECKRVKLFSTWDFDCNTFPDSYDN
YYGITPTSQAPSQTPVATPERPVVANAPPQAQKPIANQEQQAAKQEPSANPVGQRVISKE
EKVEYRDQDGNLLNEEQVEALKGKVEFKTKYETRTRVIDANGNEIQLGGSGAPKVVPAPK
ASQPVAPPHPDVQGVDQETSNVPAAEEAVPEAEKSVDGVKEAEEKVAKPASESNEATASQ
EVEQSEEVKAAQERIQKIVERIQKVADNVDNLKNNVVEKAGDKVEQVEEKAEQVAEKAQE
AAEPAKEKAAEAAEKVAEKAEEATEQSKEKVESVVDNVKEKVAERAEQVQEKAAEKAEQV
QEKAAEKAEQVQEKVAERAEQVQEKAQEAGEKAQEVVLEKADQVEKKAEQVGEKDQEKTE
AKDEL
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctccggcaagaaatcgccggcgccgccgccggcatacgccccggcctatgcc
ccgccgcccgcctatgaagctgtgccgacctccgccgtcgtattcaagaccaagaacaat
aagaacaagtccgtcaaggtcaaggacgactactcgtccgatggtgttcaggacaatgat
ccgttcctgcttcccggatccgacttcacgctcctcactatcaccacgattgtgtccgcc
attgttcgcctgttccgcatttaccagccttccagtgtcgtgtttgacgaagtccacttc
ggcggcttcgcatccaagtacatcaagggcaagttcttcatggacgtccacccgcccctc
gccaagctcatgattaccctcttcggctggctcgctgggtttgacggcaactttgacttc
aaggagattggaaaggactacattgagcctggcgttccttatgttgccatgcgcatgttc
ccggccatctgcggtatccttttggctcctaccatgttccttacactcaaggcagctgga
tgccgtagcaccaccgccttcttgggagctggtcttatcatcttcgagaacggccttctt
actcaggcccgacttatcttgcttgactcgcccctgatgattggaaccgcccttactgcc
ctcggctttactgcgtttaccaaccaacaagagctggggcctgctaaggccttcacgcca
agctggtggttctggctggccatcaccggtcttggcttgggaatcaccgctagcatcaag
tgggttggtttgttcaccattgcgtgggttggcagcttgactttgattcagctctgggtt
gtgcttggcgattacaagcacgtttcccctcgcgcgttcaccaaacacttcatggcccgc
gctttctgcctcattgtcatccctcttagtttctatttggccatgttcggaatccacttc
ctgtgccttaccaaccctggtgagggtgacggtttcatgagctccgagttccagtcgact
ctgaactcgaagggtatgcaagatgtcccggccgacattcttatgggtagccgtgttacc
atcaggcacgtcaacacccagggaggctatcttcattcgcacccgttgatgtaccccact
ggctcaaagcagcagcagattactctctatccccacaaggatgacaacaacatctggctc
ctcgagaaccagactcagcctctcggcatcgatggtcagcccatcaacggaactagcgcg
tggaacaacctccccgaaaccccctatatcaaggatggcgcgattctccgtctttatcat
ctgcctacccatcgtcgtctccattctcatgacgttcgtccccctgttaccgaggctgat
tggcagaacgaggtctcggcttatggctatgagggcttcgatggagatgccaacgacttt
ttccgtgtcgagatcgttaagaagaagtctaagggcggcgttgctcaggaacgtcttcgt
accattgacaccaagttcaagctggtgcacatcatgactggctgtgttcttttctcccac
aaggtcaagcttcctgattgggcctcggaacaacaggaggttacctgcgccaagggcggc
tccctccccaacagtctttggtacatcgagtccaacgaccatcctcagctcggagctgac
gccgaaaaggtcaactatcgcaaccctggattcttcggcaagttctgggagcttcagaag
gtcatgtggaagacgaatgccggtcttgttgagtctcatgcctgggattctcgccccgag
gcttggcctatcctccgccgcggtatcaacttctggggcaggcaacaccgccaggtttac
ttgatgggtaaccccatcatctggtggagcgctactgccgctgttgtcctctatgtcctt
ttcaagggcatcgctattctccgctggcagcgcagctgcaacgattacgctaaccccatc
ttcaagcgcttcgattacgaggttggaacctcagttcttggatgggctctccactatttc
cccttttacctcatgcagcgtcagctcttcctgcatcattacttcccggccttgtacttc
gccattattgccttttgccaagtctttgactttttgacagccagaatctctctcgtcaag
gacaaggttattttcaatagactcggagccgttttgttccttgccttgtcgatggtcgtt
ttctggctgttctctcctctggcctacggtaacccctggaccaaggctgaatgcaagagg
gtcaagcttttcagcacctgggatttcgactgcaataccttcccggatagctacgacaac
tactacggaattacccccaccagccaggcaccttcccagaccccggtggccacgcctgag
aggcctgttgtggccaatgcgcctcctcaggctcagaagcctattgcaaaccaggagcaa
caagccgccaagcaggagcctagtgccaacccggtcggccagcgcgtcatctctaaggag
gagaaggtcgagtatcgtgatcaggatggtaaccttctcaacgaggagcaagttgaggcg
ctcaagggcaaggttgagttcaagaccaagtatgagacgagaacacgtgtcatcgatgcc
aatggcaacgagattcaactcggtggaagcggtgcacccaaggttgttccggctcccaag
gcttctcagcccgttgcgcccccgcatccggatgtccaaggtgtcgaccaggagacttct
aatgttcccgctgccgaagaggccgttcccgaagccgagaagagcgtcgacggagtgaaa
gaagccgaagagaaggtcgctaagcccgccagcgagagcaatgaagccaccgcttcgcag
gaggtcgagcagagcgaggaagtcaaggccgctcaggagaggatccagaagattgttgag
cgtattcagaaggtggccgacaatgtcgataacctgaagaacaatgtcgttgagaaggct
ggcgacaaggtcgagcaggtcgaggagaaggccgagcaggtcgcggaaaaggcgcaagag
gccgctgaaccagccaaggagaaggctgcggaggctgccgagaaggttgccgagaaggcc
gaagaggcgactgagcaatcaaaggagaaggttgagagtgtggttgacaacgttaaggag
aaggtcgccgagagggctgagcaggtccaggagaaggccgccgagaaggctgagcaggtt
caggagaaggccgccgagaaggctgagcaggttcaggagaaggtcgctgagagggctgaa
caggttcaggagaaggcccaagaagctggagaaaaggcccaggaagtggtcttggagaag
gccgaccaggtcgagaagaaggccgagcaagttggagagaaggaccaggagaagacggag
gcgaaggatgagctctag

DBGET integrated database retrieval system