KEGG   Sordaria macrospora: SMAC_06950Help
Entry
SMAC_06950        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SMAC_06950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_10
Motif
Other DBs
NCBI-GeneID: 10806629
NCBI-ProteinID: XP_003349114
UniProt: F7W4V6
Position
Unknown
AA seq 329 aa AA seqDB search
MKATLMMLLAPLAAMAAPTPDNLEARQASQSIDTLIKAKGKLYYGACTDQGRLTSGKNAA
ILQQNFGQVTPENSMKWDSLQSQRGKFNWGQADYLVNWATTNNKTLRGHTFLWHSQLAGW
VGNIRDKSQLTTVLQEHITTVMTRYKGKIYGYDVANEIFNEDGSLRSSPFYNVLGEDMVS
IAFKAARAADPDAKLYINDYNLDSPNAAKLTRGMVQHVNKWVAAGVPIDGIGTQGHISSG
GGNNLAAAIKALAAANIKEVAVTELDIQGNNAGDYATITKGCLSEPKCVGITVWGVRDPD
SWRPQGNPLLFDSNYNAKAAYTSIVQALQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccactctcatgatgctgttggcgcctctggcggccatggcagcgcccaccccc
gataacttggaggctcgtcaggccagccaaagcatcgacactctgatcaaggccaagggc
aagctctactatggtgcctgcaccgaccagggccgtctcacctcgggcaagaacgcggcc
attctccagcagaactttggccaggtcacccccgagaacagcatgaagtgggatagcctc
cagagccagaggggtaaattcaactggggccaggccgactacctcgtcaactgggccacc
accaacaacaagaccctccgtggccacaccttcctctggcactcgcagcttgccgggtgg
gtcggcaacatccgcgacaagagccagttgactacggttctccaggagcacatcaccacg
gtcatgacccgctacaagggcaagatctatggctatgacgtcgccaacgaaatcttcaac
gaagacggctccctccgcagcagtcccttctacaacgtcctcggcgaagacatggtctcg
attgccttcaaggcggcccgcgcggctgacccggacgccaagctgtacatcaacgactac
aacctcgacagccccaacgccgccaagctgaccaggggcatggtccagcatgtcaacaag
tgggtggccgccggcgtgcccatcgacggcatcggcacccagggccacatcagctccgga
ggcggcaacaaccttgccgctgccattaaggcgcttgctgctgccaatatcaaggaggtc
gccgtcacggagctcgatatccagggtaacaatgcgggtgattatgctactattaccaag
gggtgcttgagcgagcccaagtgtgttggtattactgtttggggtgtgcgcgatccggac
tcgtggagaccccaagggaaccccctccttttcgattccaactacaacgccaaggctgcg
tacacctccattgtccaggctctccagtaa

DBGET integrated database retrieval system