KEGG   Sordaria macrospora: SMAC_06995Help
Entry
SMAC_06995        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
smp  Sordaria macrospora
Pathway
smp00040  Pentose and glucuronate interconversions
smp01100  Metabolic pathways
Module
smp_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMAC_06995
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SMAC_06995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 10806621
NCBI-ProteinID: XP_003349159
UniProt: F7W500
AA seq 336 aa AA seqDB search
MKSLLSFLPLILSLFPPAALAATRTSPPSTTCLTVGPSSSQKFSTIQSAINALSTTSSSP
QCIFIYPGTYREQVLIPSRAAQLSIYGSTTSTLSYASNAVTILSSKSQADGLTNDETATL
RVKSKNARLYNLNVENGYGKGSQAVALSVYAEGVGVYGCQLKGFQDTVLAQEGAQVYARS
LIQGATDFIFGQRAPAWFEKCDIRVVAASIGYITASGRDSSTNPNNYVFNACTIAAADGH
SISSGAYYLGRPWREYARVTFQKTSMTNVINAAGWKIWNTGDERTSNVAFTEYANTGAGA
SGTRAGFSSKLGAAVKIESVLGSGYAGQGYYDGSYM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctcctctcctttctccctcttattctctccctcttcccccccgccgccctc
gccgccacccgcacctcccccccatccaccacgtgcctcaccgtcggcccctcctcatcc
caaaaattctccacaatccaatccgccatcaacgccctctccaccacctcttccagcccc
caatgcatcttcatctaccccggcacttaccgtgaacaagtcctcatcccctctcgcgcc
gcgcaactatccatttacggatcaaccacctccacgcttagctacgcttccaacgccgtc
actattttgtcgtcgaaatcgcaggcggacgggttaacgaatgatgagacggccacactg
agggtgaagagcaagaatgcgcgattgtataatttgaatgtggagaatgggtatggaaaa
ggaagtcaggcggtagcgttgagtgtctatgcggagggcgtgggggtttatggctgtcag
ttgaaggggtttcaggatacggttttggcgcaggagggggcgcaggtttatgctaggtcc
ctgatccaaggagccacggacttcatcttcggccaacgagcaccagcctggttcgaaaaa
tgcgacatcagagttgttgccgccagcattggatacatcactgcctccggccgcgactcc
tccaccaacccaaacaactacgtgttcaacgcctgcaccatcgccgccgccgacggccac
tcgatctcctcgggcgcctactacctcggtcgtccctggcgcgaatacgcccgcgtgacg
ttccaaaagaccagcatgaccaacgtcatcaacgctgccgggtggaagatctggaatacg
ggcgacgagaggaccagcaatgttgcgtttaccgagtatgctaataccggtgccggagcc
agtgggacgagagcggggtttagtagtaagttgggtgctgcggtcaagattgagagtgtt
ttggggagcgggtatgctggtcaggggtactatgatggtagttatatgtaa

DBGET integrated database retrieval system