KEGG   Sordaria macrospora: SMAC_07080Help
Entry
SMAC_07080        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
smp  Sordaria macrospora
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:smp00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SMAC_07080
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SMAC_07080
Protein kinases [BR:smp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SMAC_07080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MPLPGLGFLKKKRAKEGNTDPSSTSHPTSPVTPTSASSLNHNSIQSSIAQVSSHSSASQA
ASQSATAGTSSFTIDTDHTPIPLPHETPVNMNSLPVQQHSYPPQHTPSPGAAEQQQNLPS
ISNLIHQPQYDQPGTYQQSSRYVPSVSPANGGLPAPHTPQPSMPQTQQASLQPPHHQQQQ
QQSQAQQQQQQQPQQQQQQQQQQLQPQPGQPRVTKGKYSLADFEILRTLGTGSFGRVHLV
QSRHNSRFYAVKVLKKAQVVKMKQVEHTNDERRMLGEVKHPFLITLWGTFQDSKNLYMVM
DFVEGGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHSRDIIYRDLKPENLLLDRHGHL
KITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWD
GSSPMKIYENILKGKVRYPQWVNPDAQDLLERLITADLTKRLGNLYGGPSDVKRHPWFAE
VTWDRLARKDIDAPYTPPVKAGAGDASQFDRYPEETERYGSGGSDEFGHLFQDF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgcctggcctcggtttcctcaaaaagaaacgggcgaaagagggcaatacggac
ccttcttcgactagccacccaaccagccccgtcacccctacctcggcctcgagcctcaac
cacaactccatccagagcagcatcgcccaggtctcgtcgcactcgagtgcgtcgcaggcc
gcttcccagtcggccacggccggcacttccagtttcaccatcgatacagaccacacaccc
atccccttgccgcacgagactcccgtcaacatgaattccctcccggttcaacagcattcc
tatccccctcagcacacgccctctcctggagccgcggagcagcagcagaacctcccgtcc
atctccaacctcatacaccaaccgcaatacgaccagcccggcacctatcaacagtcgtcc
agatacgtcccatctgtatccccagctaacggcggcctgcctgcgccgcacacgccccag
ccctccatgccccaaacacagcaagcatcactgcagccgccccatcaccagcaacagcag
cagcaatctcaagctcagcagcagcaacagcaacagccccaacagcagcagcagcagcag
cagcagcaactacagcctcagcctggtcagcccagggttaccaagggcaagtattcgctc
gccgacttcgagatattgagaaccctcggcaccggtagcttcggcagagtccacctggtc
cagtctcggcataactcgcgcttctatgccgtcaaggtgttgaaaaaggcccaagtggtc
aagatgaagcaagtcgaacacaccaatgacgaaagaagaatgctcggggaggtcaagcac
cctttcctaatcacgctatggggaacgtttcaggactccaagaatctctacatggtgatg
gatttcgtagagggtggcgagctcttctcgctgctgaggaagtccgggcgcttccctaac
cccgttgccaaattttacgctgctgaggtcacgttggccttggagtacctgcactcgcgg
gatatcatttacagagatctgaagcctgaaaaccttcttcttgaccgccacggccatctc
aagattacggatttcgggttcgccaagcgagtgccagataagacgtggacgctatgtggc
actccagactatttggctccagaggttgtttccaacaagggctacaacaaatctgtagat
tggtggtcgctgggtattttgatttacgaaatgctttgcggttacacgcccttctgggac
ggaagctcccccatgaagatctacgaaaacattctcaagggcaaggtcagatacccgcag
tgggtcaaccccgacgcccaggacttgttggaacggttgatcacggcagacctgaccaag
cgccttggaaacctgtacggcgggccttcagacgtcaagagacacccttggtttgccgag
gtgacctgggaccgacttgcgaggaaagacattgatgcgccctataccccgccggtcaag
gccggagcaggagacgcaagccagttcgataggtacccagaggagactgagcggtatgga
tcaggagggtcggatgaattcggccacttgttccaggacttttaa

DBGET integrated database retrieval system