KEGG   Sordaria macrospora: SMAC_07143Help
Entry
SMAC_07143        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
smp  Sordaria macrospora
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SMAC_07143
  Amino acid metabolism
   00380 Tryptophan metabolism
    SMAC_07143
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SMAC_07143
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SMAC_07143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 772 aa AA seqDB search
MIGVESKEDTIIGGKYEIPKGQPFALLFAKSTLDPAVYGDTANDFMPERMLDDNFERLNK
EFPDFWKPFGNGMRACIGRPFAWQEALLVMAVCLQNFNFMPEDPNYTLQYKQTLTTKPKG
FYMRAMLRDGMSALDLERRLSGELIAPKPAQTQSSGQPKKSGEGKPISIYYGSNTGTCET
FAQRLASDAEAHGFTATVLDSLDAANQNLPKDRPVIFITASYEGQPPDNAALFVGWLESL
AGNELEGVQYAVFGCGHHDWAQTFHRIPKLVDNTVADRGGDRICSMGLADAAKGEMFTDF
EQWEDEVFWPAMEEKYEVSKKEDDPSEALFQSGITVNFSKPRSSTLRQDVQEAVVVDAKT
ITAPGAPPKRHIEIQLSSESGAYRTGDYLAVLPINPKETVNRVMRRFQLAWDTNITIAAS
RQTTLPTGVPVAVVDVLGAYVELSQPATKKNILALAEACTDEDAETKATLRSLAGPEYTE
KITSRRVSILDLLERYPSIPLPFSSFLSLLPPMRVRQYSISSSPLWNPSHVTLTYSVLET
PSLSNPDKKHVGVATSYLASLEAGDKLNVSVRPSHKAFHLPVDADKTPLIMVAAGSGLAP
FRGFVQERAAQIGAGRNLAPAVLFYGCRHPQQDDLYREEFNKWEAMGAVSVRRAFSRDVD
NEETKGCKYVGDRIWEDREELLGLWDRGAKVYVCGSREVGESVKNTIIKIAVERQKRIVE
AREKGELDGLEGLVEGLKLQGLKVEEVEVSEERALKWFEGVRNERYATDVFD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgtcgagtccaaggaggacaccatcatcggcggcaagtacgagattcccaag
gggcagccctttgctctcttgtttgccaagtccacactggacccggctgtctacggcgac
acagccaacgacttcatgcccgagcgcatgctggacgacaactttgagcgcttgaacaag
gagttccccgatttctggaagccatttggcaacggcatgcgcgcctgcatcggtcgtccg
ttcgcctggcaggaggccttgctggtcatggctgtctgcttgcagaacttcaactttatg
cccgaggaccccaactataccctccagtacaagcagacgcttaccaccaagcccaagggc
ttctacatgcgcgccatgctccgtgatggaatgtctgccctggacttggagcgtcgtctg
tcgggtgagctcattgctcccaagcctgctcagactcaatcctctggacagcccaagaag
agcggagagggcaagcctatcagcatctactatggttccaatactggtacttgcgagacc
tttgctcagcgcctggcttccgacgctgaggcgcacggtttcacggctactgtcctcgac
tcgttggatgccgccaaccagaacttgcccaaggatagaccggtcatcttcatcactgcc
tcctacgagggtcagccccctgataacgctgctttgttcgttggctggctcgagagcttg
gctggtaacgagttggagggtgtccaatatgctgtctttggctgcggtcaccacgactgg
gcgcagaccttccatcgcattcccaagcttgtcgataacaccgttgctgaccgcggtggt
gaccgtatctgctctatgggtcttgccgacgccgccaagggcgagatgtttaccgatttc
gagcaatgggaggacgaagtgttctggcctgccatggaagagaagtacgaggtcagcaag
aaggaggatgatccctccgaggctttgttccagtctggcatcactgtcaacttctccaag
ccccgctcttccactttgcgtcaagatgttcaggaggctgtggtcgtcgatgccaagacc
atcaccgcccctggtgctcctcccaagcgccacatcgagatccagctctcgtccgaatcc
ggtgcttaccgcactggcgattacctggccgtcctgcccatcaaccccaaggagacggtg
aaccgcgtcatgcgccgcttccagttggcctgggataccaacatcaccatcgcagcttcc
cgccagaccaccctgcccaccggtgtgcccgttgctgttgttgacgtcttgggagcctac
gtcgagctctcccagccggccaccaagaagaacatcctcgctctggccgaagcctgcacc
gatgaagatgccgagaccaaggccaccctccgctcgttggcaggacccgaatacactgag
aagatcacctctcgccgcgtttccatcctcgaccttctcgagcgatacccctccatcccc
ctccccttttcctccttcctctctttgttgccgcctatgcgtgtccgccaatactccatc
tcctcttctcccctctggaacccctcccacgtaacactcacctactccgtcctcgagacc
ccctccctctccaaccccgacaagaagcacgtcggcgtagccacctcctacctcgcctcc
ctcgaagccggcgacaagctgaacgtctccgtccgcccctcgcacaaggccttccacctc
cccgtcgacgccgacaagacgcccctgatcatggtagccgccggctcgggcctcgctccc
ttccgcggcttcgtgcaagagcgcgccgcgcaaatcggtgccggccgcaacctcgctccc
gccgttttgttttatggctgccgccacccgcagcaagacgatttgtatcgcgaggaattc
aacaagtgggaagccatgggcgcggtatccgtgcgtcgcgccttttcgcgggatgtcgac
aacgaagagacgaagggatgcaagtacgtcggggatcgcatctgggaggatcgcgaggaa
ttgttgggattgtgggatcgcggagcgaaggtgtatgtttgtggatcaagggaggtgggg
gagagtgtcaagaatacgattatcaagattgcggtggagagacagaagaggattgttgag
gcgagggagaagggagagctggatgggttggagggactggtggaggggttgaagttgcag
gggctgaaggtggaggaggtggaggttagtgaggagagggcgctgaagtggtttgagggt
gtcaggaatgagaggtatgctactgatgtttttgattga

DBGET integrated database retrieval system