KEGG   Sordaria macrospora: SMAC_07359Help
Entry
SMAC_07359        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
smp  Sordaria macrospora
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMAC_07359
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SMAC_07359
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SMAC_07359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MYLPFLTLLVTPGLVAAAIQPQAYASSADGRYKLSSYSAPVRGTGTPGTNSTWKLTIDDT
PSGRKQTIKGFGAAVTDSTVSVFDALPSSRRTALLNTLMTSAGANFTMMRHTIASSDLSA
NPSYSYDDSTTNGVNDLSLQNFNLGDRGSAMASLLAEMRRLQPSLTLIGSPWSPPGWMKL
NRVIQGTTVNNNLDHAYASQFAQYFVKYLQAYQARGAKIDAITIQNEPLNSRAQMPTMYI
YADEAGDLIQNNIGPALRNAGLDTKIWAYDHNTDQPSYPATVFLRAGGYVPAVAWHCYAN
PLDWSVLTTFHNAHPKVEQYMTECWTSARQPTPWHWVASFTMGPLQNWASGVTAWVLGTD
TNDGPHLTGSNACDKCTGLVTVDTAAGTYNLRGDYYMMTQFSKFMRKDAAVMGGTGSWTY
GDGSGLESVAATNSDDGSRAVVIENKFGNGVYVTVEAKSGELWSGLVYRNSVVTWVLPAV
EA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcccattcctcaccctcctagtaaccccaggactagtcgcagcagccatccaa
cctcaagcctacgcctcctcagcagatggcagatacaaactctcctcctacagcgctccg
gtccggggcaccggcaccccaggcaccaactcaacatggaagctcaccatagacgacacc
ccctccggccgcaaacaaaccatcaaaggcttcggtgccgccgtcaccgactccaccgtg
tccgtcttcgatgcccttccctcctctcggcgcaccgcgcttctcaacaccctcatgacc
tctgcgggagccaacttcaccatgatgcgccacaccatcgcctcttccgacctgtccgcc
aacccatcctactcgtacgacgattccaccaccaacggcgtcaacgacctttctctccaa
aacttcaacctcggcgaccgcggctccgccatggcctctctcctcgccgagatgcgccgt
ctccagccatcgctaaccctcatcggctccccctggagtccaccaggctggatgaagctc
aaccgcgtaatccaggggaccacagtcaacaacaacctcgatcacgcctacgcctcccag
ttcgcgcagtactttgtcaaatacctgcaagcgtaccaagcccgcggagccaagatcgac
gccatcaccatccaaaacgagccgttgaactcccgcgcgcaaatgccgaccatgtacatc
tacgccgacgaggccggcgatctgatccagaataacatcggtcctgccttgcgcaacgcg
ggtttagataccaagatctgggcttatgatcataacaccgaccagccgtcgtaccctgcc
actgtcttcttgagagcgggcgggtacgtgccggctgtggcgtggcattgctacgccaat
cctctggattggtccgttctgacgacttttcataacgctcatccgaaagtggagcagtac
atgaccgagtgctggacttcggcaagacagccgacgccgtggcattgggtcgcgagcttc
accatgggaccgctgcagaactgggcgagcggagtgacggcgtgggtgctggggacggat
acgaatgatgggccgcacttgacgggcagtaatgcgtgtgataagtgcacggggctggtg
acggtcgatacagcggccgggacgtataatttgaggggagattattacatgatgacgcag
ttttcgaagtttatgaggaaggacgcggcggtgatgggtggcacgggtagttggacgtat
ggtgatgggagcgggctggagagcgtggcggctacgaactcggatgatgggagtagggcg
gtggtgattgagaataagtttgggaatggggtttatgtgacggttgaggcgaagagtggg
gagctttggagcgggctggtgtacagaaactcggtggtgacttgggttctgccggctgtt
gaggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system