KEGG   Sordaria macrospora: SMAC_07391Help
Entry
SMAC_07391        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K08486  
syntaxin 1B/2/3
Organism
smp  Sordaria macrospora
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SMAC_07391
SNAREs [BR:smp04131]
 Syntaxin (Qa)
  Stx-PM
   SMAC_07391
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   SMAC_07391
  Exosomal proteins of other body fluids (saliva and urine)
   SMAC_07391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 462 aa AA seqDB search
MSYGYGGRDPSFDQRDGAAGAYSPLGGRDQSPAPYAGGNYGGNTMEMSSINNGGSFAGDP
TAILNECREIDNGIEQIEGNLRELRRLQDRCLAEADSSASSSSRQLDALNTETMALYRTI
TDRVRKIKSSPEGRQPRNQAQVGRVDRRLRQAIQDYQGVESSFRKKMQDQMARQYRIVRP
DASEDEVRAAVEDTSGNSQVFQQALMQNNRVGEARAVLSAVQDRHKALQRIEQQMVELAQ
LFEQLNTLIVEQDVKIQAIEQTSEEVVDNLDKGNEEIAVAVQTARATRKKKWMCLGICVA
IIVVVVIIVVVYVVVTHPPGGGNKSEENKKRGLMPRSVTDDLQMNNARAIQIAAPMTGPI
SRIYGQSKNSLGRRLSPEGLNRITSPYKKATQPARKEKRFVITDEILEFMEQNNAVASRG
PHRAGKRFVITDEILESMRGGSKVGGHEQFVPGHHKDANDGE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagttacggatacggtggaagagacccttcctttgaccaacgggatggcgccgctggt
gcttattccccgctgggtggaagggaccagtctcccgccccctatgccggaggaaactat
ggaggaaacacaatggagatgagctcaatcaacaacggaggctcctttgccggtgatccg
actgcaatcctgaacgagtgccgagaaatcgacaatggaatcgaacagatcgagggaaat
ctacgggaactgcgaagactgcaggaccgctgcctcgccgaggccgattcatccgcgagc
tcatcgagccggcaactagatgcactcaacaccgagaccatggccttgtaccgcaccata
accgatcgcgtccgaaaaatcaagtcgagccccgagggccgccagccccgaaaccaggcc
caggttggccgcgttgaccgccgattgcgacaagcgattcaggactaccagggcgtcgag
tcctcgttccgcaagaagatgcaggaccagatggcccgccagtaccgcattgtgcgcccc
gatgccagcgaggacgaggtccgggctgccgtggaggatactagcggaaactcgcaggtc
ttccagcaagccttgatgcagaacaaccgcgtgggcgaggcgagagctgtgctcagtgct
gtacaggaccgccacaaggctttgcagaggattgagcagcaaatggtggagttggcgcag
ctgtttgagcagttgaacacgttgattgtggaacaggacgtcaagatccaggccattgag
cagacgagtgaggaggtggtcgacaatctcgacaagggcaacgaggagattgcagtggca
gtacagacggcgcgggccactcgcaagaagaaatggatgtgcttgggtatctgcgtggcc
attatcgtggtggtcgttatcatagtggtggtctatgtcgtcgtcacccaccctccaggc
ggcggaaacaaatcggaggaaaacaagaagcgcggtcttatgccacgaagcgttaccgat
gatttgcaaatgaacaacgcccgagctattcaaattgccgctcccatgaccggccctatc
tctcgtatttacggacagtcaaagaactctctcggcaggaggctctcacccgaaggtctc
aaccgcattacttcgccctacaaaaaggcaactcagccagcaagaaaggagaaacgattt
gtgatcacagatgaaatcctcgagtttatggaacaaaataacgcggtggcttcacgtggt
ccccatcgggccggaaagcgcttcgtcatcacggacgaaattttggaaagcatgagaggc
ggcagcaaagtggggggccatgaacagttcgttccaggtcaccataaggatgcgaacgat
ggcgaatga

DBGET integrated database retrieval system