KEGG   Sordaria macrospora: SMAC_07391Help
Entry
SMAC_07391        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K08486  
syntaxin 1B/2/3
Organism
smp  Sordaria macrospora
Pathway
SNARE interactions in vesicular transport
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:smp04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 462 aa AA seqDB search
MSYGYGGRDPSFDQRDGAAGAYSPLGGRDQSPAPYAGGNYGGNTMEMSSINNGGSFAGDP
TAILNECREIDNGIEQIEGNLRELRRLQDRCLAEADSSASSSSRQLDALNTETMALYRTI
TDRVRKIKSSPEGRQPRNQAQVGRVDRRLRQAIQDYQGVESSFRKKMQDQMARQYRIVRP
DASEDEVRAAVEDTSGNSQVFQQALMQNNRVGEARAVLSAVQDRHKALQRIEQQMVELAQ
LFEQLNTLIVEQDVKIQAIEQTSEEVVDNLDKGNEEIAVAVQTARATRKKKWMCLGICVA
IIVVVVIIVVVYVVVTHPPGGGNKSEENKKRGLMPRSVTDDLQMNNARAIQIAAPMTGPI
SRIYGQSKNSLGRRLSPEGLNRITSPYKKATQPARKEKRFVITDEILEFMEQNNAVASRG
PHRAGKRFVITDEILESMRGGSKVGGHEQFVPGHHKDANDGE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagttacggatacggtggaagagacccttcctttgaccaacgggatggcgccgctggt
gcttattccccgctgggtggaagggaccagtctcccgccccctatgccggaggaaactat
ggaggaaacacaatggagatgagctcaatcaacaacggaggctcctttgccggtgatccg
actgcaatcctgaacgagtgccgagaaatcgacaatggaatcgaacagatcgagggaaat
ctacgggaactgcgaagactgcaggaccgctgcctcgccgaggccgattcatccgcgagc
tcatcgagccggcaactagatgcactcaacaccgagaccatggccttgtaccgcaccata
accgatcgcgtccgaaaaatcaagtcgagccccgagggccgccagccccgaaaccaggcc
caggttggccgcgttgaccgccgattgcgacaagcgattcaggactaccagggcgtcgag
tcctcgttccgcaagaagatgcaggaccagatggcccgccagtaccgcattgtgcgcccc
gatgccagcgaggacgaggtccgggctgccgtggaggatactagcggaaactcgcaggtc
ttccagcaagccttgatgcagaacaaccgcgtgggcgaggcgagagctgtgctcagtgct
gtacaggaccgccacaaggctttgcagaggattgagcagcaaatggtggagttggcgcag
ctgtttgagcagttgaacacgttgattgtggaacaggacgtcaagatccaggccattgag
cagacgagtgaggaggtggtcgacaatctcgacaagggcaacgaggagattgcagtggca
gtacagacggcgcgggccactcgcaagaagaaatggatgtgcttgggtatctgcgtggcc
attatcgtggtggtcgttatcatagtggtggtctatgtcgtcgtcacccaccctccaggc
ggcggaaacaaatcggaggaaaacaagaagcgcggtcttatgccacgaagcgttaccgat
gatttgcaaatgaacaacgcccgagctattcaaattgccgctcccatgaccggccctatc
tctcgtatttacggacagtcaaagaactctctcggcaggaggctctcacccgaaggtctc
aaccgcattacttcgccctacaaaaaggcaactcagccagcaagaaaggagaaacgattt
gtgatcacagatgaaatcctcgagtttatggaacaaaataacgcggtggcttcacgtggt
ccccatcgggccggaaagcgcttcgtcatcacggacgaaattttggaaagcatgagaggc
ggcagcaaagtggggggccatgaacagttcgttccaggtcaccataaggatgcgaacgat
ggcgaatga

DBGET integrated database retrieval system