KEGG   Sordaria macrospora: SMAC_07467Help
Entry
SMAC_07467        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
smp  Sordaria macrospora
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:smp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SMAC_07467
Enzymes [BR:smp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SMAC_07467
Peptidases [BR:smp01002]
 Metallo Peptidases
  Family M67
   SMAC_07467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 545 aa AA seqDB search
MGSATIEAGSRPMNVKEISEKAKQYDWNPRIGFKFWARAANTIHHEGQIYLHEGSIAQAY
MFLLRYCTLVLEDMAKHPEAKLPENRALMRQLNNRINNVVEQLEQLKPQIEEAYHKWQQL
TASVEDSREKRRSTSSQYARHAASDAALSWNHISQAKILDAGSNQELAVDLARETLLKRR
RRRRQENDEEDERTRRTYAGYREENGYGVDRRQQYPTPPPTNNRYSEDDDLRRQMEATRR
QLDRSGGYGTSETDNGPPLPPKVIPFERPIPVTRPPPPPPRPRKESGSFGRDGRRNGILP
SQTIRLVTDEDDVDDRPARPPKVSEPPPEAEEKPKEANKVTFRPVAYLESGEPLRSVFLP
SSLRRRFLELARENTIRELEMCGILCGTLINNALFITCLLIPEQECTSDTCETINEEAYV
TYCIENDLLVLGWIHTHPTQTCFMSSRDLHTHAGYQTMMKESIAIVCAPRYDPSYGIFRL
TDPPGLPHIINCNTPGVFHQHGIPSDEIYCSARHAPGHVFESSRVDFEVVDLRPEGSKVP
AFRRY
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgctacgatagaggccgggagccggcccatgaatgtcaaggagatatccgag
aaagcaaaacaatacgactggaatccccggattggcttcaagttctgggcacgcgctgcc
aacaccattcatcatgagggtcaaatctaccttcatgaagggagcatagcccaagcttac
atgttcctcctccgctattgcaccctcgtcctcgaggatatggccaaacaccccgaagcc
aaactccccgaaaaccgagccctgatgaggcaactcaacaaccgcataaacaacgtcgtt
gaacagcttgaacagctcaaaccccaaatcgaagaggcctaccacaagtggcaacagctc
acagccagcgtagaagacagcagggagaaacgacgatctacatcttcccaatacgccagg
cacgctgccagtgatgctgctttgtcatggaaccatatttctcaggctaagatcctggat
gctggatcaaaccaagagttggcagtcgacttggctagggagacgctgctcaagcgacgg
agacgacgacgacaagagaacgatgaagaggacgagcgcacgcggaggacatatgcgggt
tacagggaggagaatggctatggtgtagaccggagacaacagtatcctactcccccacca
acaaacaatcgctattctgaggatgacgaccttcgccgtcaaatggaggccacaagacga
caattggaccgttcaggaggctacgggacttcggaaactgacaacggcccaccgcttccg
cccaaggtaatacccttcgagcgaccaatacccgtcactagacctcctcccccgccccca
cgcccaaggaaggagtcaggctcatttggcagagatggaaggaggaacggtatccttccc
agccagacgattcgactggtaaccgacgaggacgacgtcgacgataggccagcgagaccg
cccaaagtcagcgaaccgccaccagaagcagaagagaagccgaaagaagcgaacaaagtc
accttccgccccgtcgcctacctcgaaagcggcgaacctctccgatccgtattcctcccc
agtagtcttcgccgccgtttcctcgaactcgcccgcgaaaacaccatcagggagttggag
atgtgcggcattctctgcggcacgctaatcaacaatgcgctattcatcacctgcctgctg
attccggagcaagagtgtacctcagacacatgtgagaccatcaacgaggaagcgtacgtc
acgtactgtatcgagaacgacttgctcgtcctcggttggatccacacccacccgacgcag
acgtgcttcatgagctcgagagatttgcatacccatgccggataccagaccatgatgaag
gagagcattgccattgtttgtgcgccaagatatgatccttcatacggtatcttccgcctc
accgaccctcccggcctcccgcacatcattaactgcaatacccctggcgtctttcaccaa
catggtattccttcagacgagatctactgcagtgctcgtcatgcaccagggcacgtattt
gagtcaagtagggttgactttgaggtggtggatctcagacctgaggggtccaaggtgccg
gcgttcaggaggtattag

DBGET integrated database retrieval system