KEGG   Sordaria macrospora: SMAC_07566Help
Entry
SMAC_07566        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SMAC_07566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MAWHSSGVSNSELIENLWRNKLIKDERVKEAFLKVDRAHYSPTSPYSDSPQPIGHSATIS
APHMHASAIEHLLPSILPSPTRPAPRVLDIGSGSGYLTHVIAELVGSEGGTVVGLEHIPA
LRDLGARNMPSRRRVETFWKVDESDSDHASTAARRRSSVNERTPMGEVEGQGERKGEDKD
EGKWDAIHVGASAKEIHKELVDQLRSPGRMFVPVDDDEMGLQQHVWEVKKDEGGEVSMRR
LFGVRYVPLGDPPK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcactcatccggcgtgagcaactcggagctgatcgagaatctgtggaggaat
aagttgattaaagatgagagggttaaggaggcttttttgaaggtcgacagagcccattac
tcacccacatccccctactccgactccccccaaccaatcggccactcagccaccatcagc
gctccccacatgcacgcctcagcaatcgagcacctcctcccatcgattctcccctcccca
acccgccccgccccccgcgtcctcgacattggatcggggtctggctacctcacccacgtc
atcgccgagctagtcggctctgagggcggaacggtcgttggtttagagcacatacccgct
ttacgagacctcggcgctcgaaatatgccaagtcgcaggagggtcgagactttttggaaa
gtggacgagtccgattccgaccacgcctccaccgccgcccgccggcgctcttcggtaaac
gagcgtactcctatgggcgaagttgaggggcaaggagaaagaaagggagaggacaaagat
gaagggaagtgggatgctatccacgttggggcttctgccaaagaaattcataaggaactt
gtggatcagttgaggagtcctggacgcatgtttgtcccggttgatgatgatgagatgggt
ttgcagcagcatgtgtgggaggtgaagaaagatgagggtggggaggttagtatgaggaga
ttgtttggggtgaggtacgtgcctttgggggatcctcctaagtga

DBGET integrated database retrieval system