KEGG   Sordaria macrospora: SMAC_07929Help
Entry
SMAC_07929        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smp  Sordaria macrospora
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMAC_07929
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SMAC_07929
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMAC_07929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MKLLNLNDGVEPGVICVEPTLANDGMDARNLAKAHKGPIVSHLEHLPRGIHETSEERKNH
WFVGSVDQGTTSSRFLIFNGEGDPVASHQIEFENLYPKSGWHEHDPMTLLNSVEECIEGA
MRKFQRLGFSKNDIRSIGITNQRETTLVWDHETGEPLYNAVVWPDTRTKSIVRDLKAKDG
ADAIKDLCGLPLSTYPSSVKLLWLIENVEAVKEAYEQGRLAFGTVDTWLIYKLNGGAQAE
SPVHVTDSTNASRTMFMNIRTLQYDDKLLGFFGIDRTKVHLPKIVPSSDPECFGRIASGA
LSGVPIAGCLGDQSSALVGQCGFNPGQAKNTYGTGCFLLYNVGTEPVISQYGLLSTVAYD
FGQGRAPVYALEGSIAVAGSGVTFLQNNLNFIDNAKQINDLAESVPDNGGVVFVTAFSGL
FAPYWIDDAKGTVFGITQHTQKGHIARATLEATCFQTKAILDAMEKDSGCKLKLLAVDGG
LSNSDLTMQTQADISGIPVDRPAMCETTALGAAIAAGLATGVWNDTAELQEVNRTGRKIF
DPKISRKCAEKRFKKWNQAVQMSRGWLQDNDNEDDECDEEEKKA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagttactcaacctcaacgacggcgtcgagcccggcgttatctgcgtagaacctacc
cttgcaaacgatggcatggacgcccgcaacctagcaaaggcccacaagggtcccattgtc
agccacctagagcacctcccccgcggcatccacgagacttctgaggagaggaaaaaccac
tggttcgtcggctctgtcgaccaaggcactacctcttcccgcttccttatcttcaacggc
gagggcgaccccgttgccagccaccagatcgaatttgagaacctctaccccaagtcagga
tggcacgagcacgaccccatgacccttctcaactcggtcgaggagtgcattgagggtgct
atgcgcaagttccaacgacttggcttctccaagaacgacatccgttccatcggcatcacc
aaccagcgcgagactactcttgtttgggaccacgaaaccggcgagcctctctacaacgcc
gtcgtctggcccgacacccgcaccaagtctattgtccgcgacctcaaggccaaggatggc
gctgatgccatcaaggacctctgcggtcttcccctctccacctatcccagcagcgtcaag
cttctttggctcattgagaacgtcgaggccgtcaaggaggcctacgaacaaggccgcctc
gccttcggcactgttgacacttggctcatctacaagcttaatggcggcgcccaggctgag
agccccgtccacgtaacagacagcaccaacgccagcagaaccatgttcatgaacatccgc
actttgcagtatgacgacaagctactaggattcttcggtattgaccgaaccaaggtgcat
ttgcccaagatcgtcccttcgtcggaccctgaatgtttcggtcgcattgccagtggcgcg
ctgtcaggtgtaccgatcgccggctgcttgggcgatcaatccagcgccctggtcggccag
tgcggcttcaaccctggccaagcaaagaacacctacggcaccggctgcttccttctctac
aacgtcggcaccgagcccgtcatctcccagtatggtcttctgtccactgtcgcctacgac
tttggccagggccgtgcgcctgtctatgccctcgagggcagcatcgctgtcgccggctcc
ggcgtcaccttcctccagaacaacctcaacttcattgataacgctaagcaaatcaacgac
cttgccgagtcggtgcccgataacggaggtgttgtgttcgtcactgccttcagcggcctg
ttcgccccttactggatcgatgatgcaaagggaacagtcttcggaattacccaacacact
caaaagggacacattgctcgtgccactctcgaggctacctgcttccagaccaaggccatc
cttgatgccatggagaaggactcgggctgcaagctcaagctcctcgctgtcgatggcggt
ctttccaactcggacctgaccatgcagacccaagctgacatcagcggtattcccgttgat
cgcccggccatgtgcgaaaccactgctctgggcgctgccatcgctgccggcctcgctacc
ggtgtctggaacgatactgccgagctccaggaggtcaaccggaccggccggaaaattttc
gaccccaagatctctcgcaagtgtgccgagaagaggttcaagaagtggaaccaggccgtc
cagatgagccgcggctggctccaagacaacgacaacgaagacgacgagtgcgacgaggag
gagaagaaggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system