KEGG   Sordaria macrospora: SMAC_07929Help
Entry
SMAC_07929        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smp  Sordaria macrospora
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smp00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MKLLNLNDGVEPGVICVEPTLANDGMDARNLAKAHKGPIVSHLEHLPRGIHETSEERKNH
WFVGSVDQGTTSSRFLIFNGEGDPVASHQIEFENLYPKSGWHEHDPMTLLNSVEECIEGA
MRKFQRLGFSKNDIRSIGITNQRETTLVWDHETGEPLYNAVVWPDTRTKSIVRDLKAKDG
ADAIKDLCGLPLSTYPSSVKLLWLIENVEAVKEAYEQGRLAFGTVDTWLIYKLNGGAQAE
SPVHVTDSTNASRTMFMNIRTLQYDDKLLGFFGIDRTKVHLPKIVPSSDPECFGRIASGA
LSGVPIAGCLGDQSSALVGQCGFNPGQAKNTYGTGCFLLYNVGTEPVISQYGLLSTVAYD
FGQGRAPVYALEGSIAVAGSGVTFLQNNLNFIDNAKQINDLAESVPDNGGVVFVTAFSGL
FAPYWIDDAKGTVFGITQHTQKGHIARATLEATCFQTKAILDAMEKDSGCKLKLLAVDGG
LSNSDLTMQTQADISGIPVDRPAMCETTALGAAIAAGLATGVWNDTAELQEVNRTGRKIF
DPKISRKCAEKRFKKWNQAVQMSRGWLQDNDNEDDECDEEEKKA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagttactcaacctcaacgacggcgtcgagcccggcgttatctgcgtagaacctacc
cttgcaaacgatggcatggacgcccgcaacctagcaaaggcccacaagggtcccattgtc
agccacctagagcacctcccccgcggcatccacgagacttctgaggagaggaaaaaccac
tggttcgtcggctctgtcgaccaaggcactacctcttcccgcttccttatcttcaacggc
gagggcgaccccgttgccagccaccagatcgaatttgagaacctctaccccaagtcagga
tggcacgagcacgaccccatgacccttctcaactcggtcgaggagtgcattgagggtgct
atgcgcaagttccaacgacttggcttctccaagaacgacatccgttccatcggcatcacc
aaccagcgcgagactactcttgtttgggaccacgaaaccggcgagcctctctacaacgcc
gtcgtctggcccgacacccgcaccaagtctattgtccgcgacctcaaggccaaggatggc
gctgatgccatcaaggacctctgcggtcttcccctctccacctatcccagcagcgtcaag
cttctttggctcattgagaacgtcgaggccgtcaaggaggcctacgaacaaggccgcctc
gccttcggcactgttgacacttggctcatctacaagcttaatggcggcgcccaggctgag
agccccgtccacgtaacagacagcaccaacgccagcagaaccatgttcatgaacatccgc
actttgcagtatgacgacaagctactaggattcttcggtattgaccgaaccaaggtgcat
ttgcccaagatcgtcccttcgtcggaccctgaatgtttcggtcgcattgccagtggcgcg
ctgtcaggtgtaccgatcgccggctgcttgggcgatcaatccagcgccctggtcggccag
tgcggcttcaaccctggccaagcaaagaacacctacggcaccggctgcttccttctctac
aacgtcggcaccgagcccgtcatctcccagtatggtcttctgtccactgtcgcctacgac
tttggccagggccgtgcgcctgtctatgccctcgagggcagcatcgctgtcgccggctcc
ggcgtcaccttcctccagaacaacctcaacttcattgataacgctaagcaaatcaacgac
cttgccgagtcggtgcccgataacggaggtgttgtgttcgtcactgccttcagcggcctg
ttcgccccttactggatcgatgatgcaaagggaacagtcttcggaattacccaacacact
caaaagggacacattgctcgtgccactctcgaggctacctgcttccagaccaaggccatc
cttgatgccatggagaaggactcgggctgcaagctcaagctcctcgctgtcgatggcggt
ctttccaactcggacctgaccatgcagacccaagctgacatcagcggtattcccgttgat
cgcccggccatgtgcgaaaccactgctctgggcgctgccatcgctgccggcctcgctacc
ggtgtctggaacgatactgccgagctccaggaggtcaaccggaccggccggaaaattttc
gaccccaagatctctcgcaagtgtgccgagaagaggttcaagaagtggaaccaggccgtc
cagatgagccgcggctggctccaagacaacgacaacgaagacgacgagtgcgacgaggag
gagaagaaggcctaa

DBGET integrated database retrieval system