KEGG   Sordaria macrospora: SMAC_08023Help
Entry
SMAC_08023        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SMAC_08023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MHTSSILSLLALAAVPLASAGNGNGNGKGSGKSCSHKGLDWYAKKAGLKYFGAATDSPGQ
RERAGYESAYAKYDEIMWKSGEFGQTTPTNGQKWLFTEPAQGTFNFTEGDIVASLAAQNK
KLLRCHALVWHSQLAPWVEAKKDWTKDELRAVIVSHVTNVMNHYKGQCYAWDVVNEAFNE
DGTFRESVFSTVLGGNEFIELAFETAFSLDPKAKLYYNDYNLESPSPKTEAVRKLVRHLQ
SKKIRIDGVGLQAHLIAENRPTLDEHVAAIEGFTELGVEVALTELDVRLQTPANATNLAL
QKEGYKNVVGACVQVDGCIGVTIWDFYDPFSWVPFVFEGEGAALLWFEDFSKHPAYDGVV
EALTNKTRGHNGKGGPRGVTKRFIA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcacacctcctccatcctctccctccttgccctcgccgcggtccccttggcctcggcc
ggcaacggtaatggaaacggcaagggatccggaaagtcctgctcccacaagggcctcgac
tggtacgccaagaaggccggcctcaagtacttcggcgcggccaccgactcgcccggccag
cgcgagcgtgcgggttatgagtccgcctacgccaagtacgacgagatcatgtggaagtca
ggcgagtttggccagacgacgcctaccaacgggcagaagtggctcttcaccgaaccagcc
caaggcaccttcaacttcaccgagggtgacatcgtcgcctccctcgccgcccaaaacaag
aagctcctgcggtgccacgccctggtctggcactcgcagctcgcgccctgggtggaagcc
aagaaggactggaccaaggacgagctgcgtgccgtcatcgtctcccacgtcaccaacgtc
atgaaccactacaagggccagtgctacgcctgggacgtggtcaacgaggccttcaacgag
gacggcaccttccgggagtccgtcttctccaccgtcttgggaggcaacgagttcatcgag
ctcgccttcgagaccgcttttagcttggatcccaaggccaagctttattataacgattat
aacttggagagcccttctcctaaaacggaggcggtgaggaagttggtcaggcacttgcag
agcaagaagattcgcattgatggtgttggcttgcaggcacatcttattgcggagaacagg
ccgacgctggacgaacatgttgctgctattgaggggttcacggaattgggcgttgaggtt
gccttgaccgagttggatgtgaggctgcagacgccggcgaatgcgacgaatttggcgttg
cagaaggaggggtataagaatgtcgtcggagcatgcgtccaagtcgacggatgcatcggt
gtcaccatctgggatttctatgaccccttcagctgggtccccttcgttttcgagggcgag
ggcgccgcccttctctggttcgaggacttcagcaagcaccctgcctacgacggcgtcgtc
gaggctttgaccaacaagactcggggacacaacgggaagggtggtccccgtggcgttact
aagcgtttcatcgcttga

DBGET integrated database retrieval system