KEGG   Sordaria macrospora: SMAC_08095Help
Entry
SMAC_08095        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smp  Sordaria macrospora
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 458 aa AA seqDB search
MRGPRSLGVVIKLGTSSIVDEKTHEPLLSNLTLIVETAVKLRKDGHKVIIVSSGAIGVGL
QRMDVERRPKHISKLQALAAIGQCRLMSLWDSLFNHLRQPIAQILLTRSDISDRSRYLNA
QNTMHELLDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVHADLLFLMTDVDCLYDK
NPRTNPDAQPIEVVEDIGALVADVSQAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSN
PGNIHKIVKHIQGSRSPASLTTQVNHPSTASLASLNNGSGSGTSTPGAAAAATPSSEQAP
AAANDRSQIPLHTRFLPSASPVRDRYFWILHGLRPHGTLYIDQGAYKALLGKAGLLPVGV
VDVEGFFAQQEAVRLCVVDKRRSTPGADGKMWEGEAVEVGRCLTNYSSAEIARIKGHQSA
EIGQLLGYADSEYVAQRESVSFYNAVSRPASPVGGHRA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtcctcgttctcttggagtcgtgatcaaactcggaaccagttccattgtggac
gaaaagacacatgaaccccttctatccaacctcacccttatagtcgagacggcggtcaag
ctacgaaaagatggtcataaggtgattattgtgtcgtctggcgccattggcgttggtctc
cagagaatggacgttgagaggagaccaaaacatatctccaagttgcaggccttggcagct
atcgggcagtgccgcctaatgagtctatgggacagcttgttcaaccatctcagacagcct
atcgcccagatcttgcttaccagaagcgacatttctgatcggtcacgatacctcaatgcg
cagaacactatgcatgagctgctcgatatgggcgtgatccccatcgtcaacgagaacgat
acgctggccgtatccgaaatcaagttcggtgacaacgacactctgtcagccatcaccgcc
gccatggtccacgccgatctcctcttcctcatgaccgacgtcgactgtctttatgacaag
aaccccagaaccaaccctgacgcccaaccgattgaggttgtcgaagatatcggtgccctt
gttgccgatgtctcccaagccggctcatccctcggcacaggcggcatgtccaccaagatc
gtagccgcccgcctcgccacctccgccggcgtcaccaccgtgatcacccgctcctccaac
ccgggcaacattcacaagatcgtcaagcacatccaaggcagccgttcccctgcctccctg
actacccaagtcaaccacccctccacggcctctctcgcctccctcaacaatggttccggc
tccggcacctccaccccaggtgccgcggcggccgccacccccagctccgagcaagcccca
gctgccgccaacgaccgcagccaaatccccctgcacacgcgcttcctcccctcggcctcg
cccgtccgcgaccgctacttctggatcctgcacggcctgcgccctcacggcactctgtac
atcgaccagggcgcttacaaggctttgctcggcaaagccggccttctgcccgtcggcgtg
gtcgacgtcgagggtttctttgctcagcaagaagccgtgcgtctgtgcgttgttgataag
cgccgctctacgcccggtgccgacggcaagatgtgggagggcgaggcggttgaggtgggc
cggtgcctgactaactattcgagcgcggaaattgcgcggatcaagggacaccagagcgcg
gaaattgggcagttgcttgggtacgctgacagcgagtatgtggcgcagagggagagcgtg
agcttttataatgcggttagtaggccggctagtcctgttgggggtcatcgggcgtga

DBGET integrated database retrieval system