KEGG   Sordaria macrospora: SMAC_08139Help
Entry
SMAC_08139        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
smp  Sordaria macrospora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMAC_08139
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMAC_08139
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMAC_08139
Enzymes [BR:smp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMAC_08139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 708 aa AA seqDB search
MEGIKQTFARCKAQNRPALVTYVTAGFPRPEQTPNVLLAMEKGGADVIELGVPFTDPIAD
GPTIQTANTIALRHGVTIHSTLQMVRDARQRGLKAPVLLMGYYNPLLSYGEERLLTDCKE
AGVNGFIIVDLPPEEAVSFRQLCSRGGLSYVPLIAPATSNDRMRVLCQLADSFIYVVSRQ
GVTGASGTLNANLPELLGRVKKYSGNKPAAVGFGVSTHEHFTSVGAIADGVVVGSMIIAT
LQEAAEGEEPQAVQEYCSYLCGRNFDESAHELSMGDALEAAKEPTGTATVDSVITEADIN
SQLAALHSTIPKRFGEFGGQYVPEALMDCLSELEKGFNVIQDDPTFWEEYRSYYPWMGRP
GQLHKAERLTKYAGGANIWLKREDLNHTGSHKINNALGQVLLARRLHKTKIIAETGAGQH
GVATATVCAKFDLECTIFMGAEDVRRQALNVFRMKLLGAKVIAVEAGSRTLRDAVNEALR
HWVINLADTHYIIGSAIGPHPFPTIVRTFQSIIGNETKQQMLEKRGKLPDAVVACVGGGS
NAVGMFYPFSNTPSVKLLGVEAGGDGVDTPRHSATLTAGSKGVLHGVRTYVLQNQHGQIT
DTHSISAGLDYPGVGPELSNWKDSLRAEFVAATDSQAFEGFRLMSQLEGIIPALETSHGI
WGALELAKTMKKDEDVVICLSGRGDKDVQSVADELPIIGPKIGWTLRF
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggagggtatcaagcagacttttgcgcgctgcaaggcccagaacaggcccgcgctcgtc
acctatgtcacggccggtttcccccggcccgagcagacccccaatgttctcctggccatg
gagaagggcggcgccgacgtgatcgagctcggtgtcccctttaccgaccccattgccgat
ggcccaaccatccagactgccaacactatcgctctccggcatggcgtcactatccactcg
accctgcagatggtccgcgacgctcgccagcgtggcctcaaggctcccgtccttctcatg
ggctactacaaccctcttctcagctacggcgaggagcgtctcctcaccgactgcaaggag
gccggcgtcaacggtttcatcattgtcgacttgccccctgaggaggccgtctctttccgc
cagctctgcagccgcggtggtctctcttacgtccctcttattgcgcccgccacttcgaac
gaccgtatgcgcgttctctgccagctcgccgactccttcatctacgtcgtctcccgccag
ggtgtcaccggcgcttctggcactctcaacgccaaccttcccgagctcctcggccgcgtc
aagaagtacagcggcaacaagcccgctgctgttggtttcggtgtcagcacccatgagcac
ttcacttccgtcggcgccattgccgacggtgtcgttgttggtagcatgatcatcgccact
ctccaggaggccgccgagggcgaggagccccaggctgtccaggagtactgctcttacctc
tgcggccgcaactttgacgaatccgctcacgagctcagcatgggcgacgctcttgaggcc
gccaaggagcccacgggtaccgccactgtcgacagcgtcatcaccgaggccgacattaac
tctcagctcgccgctctccacagcaccattcccaagcgtttcggcgagttcggtggtcag
tacgtccctgaggcgctcatggactgtctttccgagcttgagaagggtttcaatgtgatc
caggatgatcccactttctgggaagagtaccgctcttactacccctggatgggtcgtccg
ggtcagcttcacaaggccgagcgtctcaccaagtatgctggtggtgccaacatctggttg
aagcgtgaagatctcaaccacactggttcccacaagatcaacaacgctctcggccaggtg
cttctcgcgcgcagactccacaagacgaagattatcgccgagaccggtgccggtcagcac
ggtgtcgccaccgctaccgtctgcgccaagttcgacttggagtgcaccatcttcatgggt
gccgaggatgtccgtcgccaggctctcaacgtcttccgcatgaagcttctcggcgccaag
gtcatcgccgtcgaggccggcagccgcaccctccgcgatgccgtcaacgaggctctccgc
cactgggtcatcaaccttgccgatactcactacatcatcggctccgctattggccctcac
cccttccccaccattgtgcgcactttccaatccatcatcggtaacgagaccaagcagcag
atgctggagaagcgcggcaagctccccgatgccgtcgtcgcctgcgttggtggtggtagc
aatgctgtcggcatgttctaccccttctcaaacacccccagcgtcaagctcctcggtgtc
gaggccggtggcgacggtgtcgacactccccgccacagtgccaccctcactgccggtagc
aagggtgtcttgcacggtgtccgtacctacgtcctgcagaaccagcacggccagatcacg
gacacccattccatctctgccggtctcgattaccccggtgtcggtcccgaactgtccaac
tggaaggattccctgcgcgccgagttcgtggctgccacggattctcaggcctttgagggt
ttccgtctgatgtcccagctggagggtatcatccctgcgctcgagacttctcacggtatt
tggggcgctcttgagctggccaagaccatgaagaaggatgaggatgttgtcatctgcttg
tctggtcgtggtgataaggatgtccagagcgttgctgatgagcttcctattatcggacct
aagattggctggaccttgcgcttttaa

DBGET integrated database retrieval system