KEGG   Sordaria macrospora: SMAC_08139Help
Entry
SMAC_08139        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
smp  Sordaria macrospora
Pathway
smp00260  Glycine, serine and threonine metabolism
smp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
smp01230  Biosynthesis of amino acids
Module
smp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMAC_08139
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMAC_08139
Enzymes [BR:smp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMAC_08139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 10801491
NCBI-ProteinID: XP_003344206
Position
Unknown
AA seq 708 aa AA seqDB search
MEGIKQTFARCKAQNRPALVTYVTAGFPRPEQTPNVLLAMEKGGADVIELGVPFTDPIAD
GPTIQTANTIALRHGVTIHSTLQMVRDARQRGLKAPVLLMGYYNPLLSYGEERLLTDCKE
AGVNGFIIVDLPPEEAVSFRQLCSRGGLSYVPLIAPATSNDRMRVLCQLADSFIYVVSRQ
GVTGASGTLNANLPELLGRVKKYSGNKPAAVGFGVSTHEHFTSVGAIADGVVVGSMIIAT
LQEAAEGEEPQAVQEYCSYLCGRNFDESAHELSMGDALEAAKEPTGTATVDSVITEADIN
SQLAALHSTIPKRFGEFGGQYVPEALMDCLSELEKGFNVIQDDPTFWEEYRSYYPWMGRP
GQLHKAERLTKYAGGANIWLKREDLNHTGSHKINNALGQVLLARRLHKTKIIAETGAGQH
GVATATVCAKFDLECTIFMGAEDVRRQALNVFRMKLLGAKVIAVEAGSRTLRDAVNEALR
HWVINLADTHYIIGSAIGPHPFPTIVRTFQSIIGNETKQQMLEKRGKLPDAVVACVGGGS
NAVGMFYPFSNDPSVKLLGVEAGGDGVDTPRHSATLTAGSKGVLHGVRTYVLQNQHGQIT
DTHSISAGLDYPGVGPELSNWKDSLRAEFVAATDSQAFEGFRLMSQLEGIIPALETSHGI
WGALELAKTMKKDEDVVICLSGRGDKDVQSVADELPIIGPKIGWTLRF
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggagggtatcaagcagacttttgcgcgctgcaaggcccagaacaggcccgcgctcgtc
acctatgtcacggccggtttcccccggcccgagcagacccccaatgttctcctggccatg
gagaagggcggcgccgacgtgatcgagctcggtgtcccctttaccgaccccattgccgat
ggcccaaccatccagactgccaacactatcgctctccggcatggcgtcactatccactcg
accctgcagatggtccgcgacgctcgccagcgtggcctcaaggctcccgtccttctcatg
ggctactacaaccctcttctcagctacggcgaggagcgtctcctcaccgactgcaaggag
gccggcgtcaacggtttcatcattgtcgacttgccccctgaggaggccgtctctttccgc
cagctctgcagccgcggtggtctctcttacgtccctcttattgcgcccgccacttcgaac
gaccgtatgcgcgttctctgccagctcgccgactccttcatctacgtcgtctcccgccag
ggtgtcaccggcgcttctggcactctcaacgccaaccttcccgagctcctcggccgcgtc
aagaagtacagcggcaacaagcccgctgctgttggtttcggtgtcagcacccatgagcac
ttcacttccgtcggcgccattgccgacggtgtcgttgttggtagcatgatcatcgccact
ctccaggaggccgccgagggcgaggagccccaggctgtccaggagtactgctcttacctc
tgcggccgcaactttgacgaatccgctcacgagctcagcatgggcgacgctcttgaggcc
gccaaggagcccacgggtaccgccactgtcgacagcgtcatcaccgaggccgacattaac
tctcagctcgccgctctccacagcaccattcccaagcgtttcggcgagttcggtggtcag
tacgtccctgaggcgctcatggactgtctttccgagcttgagaagggtttcaatgtgatc
caggatgatcccactttctgggaagagtaccgctcttactacccctggatgggtcgtccg
ggtcagcttcacaaggccgagcgtctcaccaagtatgctggtggtgccaacatctggttg
aagcgtgaagatctcaaccacactggttcccacaagatcaacaacgctctcggccaggtg
cttctcgcgcgcagactccacaagacgaagattatcgccgagaccggtgccggtcagcac
ggtgtcgccaccgctaccgtctgcgccaagttcgacttggagtgcaccatcttcatgggt
gccgaggatgtccgtcgccaggctctcaacgtcttccgcatgaagcttctcggcgccaag
gtcatcgccgtcgaggccggcagccgcaccctccgcgatgccgtcaacgaggctctccgc
cactgggtcatcaaccttgccgatactcactacatcatcggctccgctattggccctcac
cccttccccaccattgtgcgcactttccaatccatcatcggtaacgagaccaagcagcag
atgctggagaagcgcggcaagctccccgatgccgtcgtcgcctgcgttggtggtggtagc
aatgctgtcggcatgttctaccccttctcaaacgaccccagcgtcaagctcctcggtgtc
gaggccggtggcgacggtgtcgacactccccgccacagtgccaccctcactgccggtagc
aagggtgtcttgcacggtgtccgtacctacgtcctgcagaaccagcacggccagatcacg
gacacccattccatctctgccggtctcgattaccccggtgtcggtcccgaactgtccaac
tggaaggattccctgcgcgccgagttcgtggctgccacggattctcaggcctttgagggt
ttccgtctgatgtcccagctggagggtatcatccctgcgctcgagacttctcacggtatt
tggggcgctcttgagctggccaagaccatgaagaaggatgaggatgttgtcatctgcttg
tctggtcgtggtgataaggatgtccagagcgttgctgatgagcttcctattatcggacct
aagattggctggaccttgcgcttttaa

DBGET integrated database retrieval system