KEGG   Sordaria macrospora: SMAC_08323Help
Entry
SMAC_08323        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
smp  Sordaria macrospora
Brite
Chromosome and associated proteins [BR:smp03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    SMAC_08323
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SMAC_08323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RP-C
Motif
Other DBs
NCBI-GeneID: 10801666
NCBI-ProteinID: XP_003344380
UniProt: F7VV81
Position
Unknown
AA seq 137 aa AA seqDB search
MPPKPADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKARKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagcccgccgacaagaagcccgcctccaaggcccccgctactgcctccaag
gcccccgagaagaaggatgccggaaagaagactgccgcctctggcgacaagaagaagcgc
accaaggcccgcaaggagacctactcctcctacatctacaaggtcctcaagcaggtccac
cccgataccggtatctccaaccgcgccatgtctatcctgaactccttcgtcaacgatatc
ttcgagcgcgtcgctactgaggcctccaagctcgctgcctacaacaagaagtccaccatc
tcctcccgcgagatccagacctctgtccgcctcatcctccccggtgagcttgccaagcac
gccgtgtcggaaggcaccaaggccgttaccaagtactcctccagcacgaaataa

DBGET integrated database retrieval system