KEGG   Sordaria macrospora: SMAC_08326Help
Entry
SMAC_08326        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smp  Sordaria macrospora
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMAC_08326
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMAC_08326
  Amino acid metabolism
   00310 Lysine degradation
    SMAC_08326
Enzymes [BR:smp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMAC_08326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 417 aa AA seqDB search
MLYKGLRLAARAAPKLALCNANPALRQLPLQFQHVRNYADQVIKVPQMAESISEGTLKQW
SKKVGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLVNEEDTVTVGQGIVRLELGGAP
KEGGAEKPAAPESKEAAPKDSAPAPAPEKAPEPKQETKPAAAPAPTPAKKETPAKEAPAT
LGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALMDFRKQYKDEILKKTGV
KLGFMSAFSRACVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRN
VETMDLVNIEKSIADMGKKARDGKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQSAVL
GLHAIKERPIAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLVKVKEYIEDPRKMLL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaggtcttcgtcttgcggcccgcgccgctcccaaactcgcgctctgcaac
gcaaatcccgcgctccgacagcttcccctgcagttccagcatgtccgcaactacgccgac
caggtcatcaaggtcccgcagatggccgagtccatcagtgagggcaccttgaagcagtgg
agcaagaaggttggcgactatgtcgagcaggacgaggagatcgcgaccatcgagaccgac
aagattgatgtggccgtcaacgctcccgaggccggtacgatcaaggagttcctcgttaat
gaggaggacactgtcacagtcggccagggcattgtccggctagagcttggcggtgcgccc
aaggagggcggtgctgagaagccggccgcgcccgagagcaaggaggctgctcccaaggac
agcgctcctgctcctgctcccgagaaggctcccgagcctaagcaggaaaccaagcccgcc
gctgctcctgcccccacgcctgccaagaaggaaactcctgcgaaggaggccccggctacc
ctcggcaaccgcgaggagcgcagagtcaagatgaaccgcatgcgcctccgcatcgccgag
cgtctcaagcagtcccagaacaccgctgcctcgcttaccaccttcaacgaagttgacatg
tccgccctgatggatttccgcaagcagtacaaggatgagatcctcaagaagaccggcgtc
aagctcggcttcatgagcgccttctcccgcgcctgtgtcttggccatgcgcgacatcccg
gccgtcaacgcctctattgagggtcccaacggcggtgacaccattgtctatcgggattat
gttgacatcagtgtcgctgtggccaccgagaagggtcttgtcactcctgtagtccgcaat
gttgagaccatggacctcgttaacattgagaagtctatcgcggatatgggcaagaaggct
cgtgacggtaagctcaccattgaggacatggctggcggaactttcaccatcagcaacggc
ggcgttttcggctccttgatgggtacccctatcatcaaccttcctcagagcgcagttttg
ggtctccatgctatcaaggagcgccctatcgctgttaacggaaaggttgagattcgcccc
atgatgtacttggctctcacctacgaccacagactgcttgatggcagagaggctgtccag
ttcctggtcaaggtgaaggagtacattgaggaccccaggaagatgcttctttaa

DBGET integrated database retrieval system