KEGG   Sordaria macrospora: SMAC_08506Help
Entry
SMAC_08506        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
smp  Sordaria macrospora
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MAATFTLDEVRKHNSKNDVWMVIHNKVYNATSYLEDHPGGSIILREVAGTDATEQFVEVG
HSAETDDILKELYVGDLAEDEHAEEVEIFRPTFEKVAMEAAVDVKQLANSKLRKNGKKTV
AMSSIIASVGAVGLAKGWWTGPEWAMAAVTTAQKPIGQLADFIRSKFAQNGGSSKLFWWG
VGIATVVELSLTTAVTTWALSKFEAQKEFTHFPRSRPAKKERKMAILKIPTNSTSGPAVK
PPVKVIDPADWRKFKLVRKVLVSPNVFHLVFALPHPTDVLGLPTGQHIALRANIDGKSVS
RSYTPVSNNSDLGRVELLIKVYDKGLMTKHLEGMQIGDQIEIRGPKGAMQYAPNSYAKEI
GMIAGGTGITPMYQLIRAICEDESDKTKISLLYANNTEADILLRQELDGFVKAFPEKLSV
QYVLSQGDENWKGLKGFVTADMIKQFLPPAADSTKMLLCGPPPMVAAMSKNLVSLGFKAP
GTLSKATDQVFLF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccgccacattcaccctcgacgaagtgcgcaagcacaacagcaagaacgacgtttgg
atggttattcacaacaaggtctacaatgccacatcatacctcgaggatcaccccggtggc
tccatcattcttcgtgaggttgccggtaccgatgcgaccgagcagttcgtcgaagtcgga
cattctgccgagaccgacgatatcctaaaagagctctacgttggtgatttggccgaagat
gaacacgccgaggaggtcgagatcttcaggccaacattcgaaaaggtcgccatggaggcc
gctgtcgacgtcaagcagctcgccaattccaagctcaggaagaacggcaagaagaccgtc
gccatgtcttccatcatcgccagcgtcggcgccgtcggtcttgccaagggctggtggact
ggccccgaatgggctatggccgccgtcaccaccgcgcagaagcccatcggccagctcgcc
gacttcatccgctccaagttcgcccaaaacggcggctcttccaagcttttctggtggggt
gtcggcatcgccaccgtcgtcgagctctccctgaccaccgccgtcaccacctgggctctt
tccaagtttgaggcccagaaggagtttacccacttcccccgtagccgtccggccaagaag
gagcgtaagatggccatcctcaagatccccaccaactccaccagcggtcccgccgtcaag
cctcccgtgaaggtgatcgaccccgcggactggcgcaagttcaagctcgtccgcaaggtg
ttggtttcccccaacgtcttccacctcgtcttcgccctcccccaccccaccgacgtcctc
ggccttcccaccggccagcacatcgctctccgcgccaacatcgacggcaagtccgtctcg
cgctcgtacacccccgtgtccaacaactctgatctcggccgcgtcgagctcctcatcaag
gtctacgacaagggtctcatgaccaagcacctcgagggcatgcaaatcggcgaccagatc
gagatccgcggccccaagggcgccatgcagtacgcccccaacagctatgccaaggaaatc
ggcatgattgccggcggtaccggtatcacgcccatgtaccagcttatccgcgccatctgc
gaggacgagagcgacaagaccaagatctcgctgctgtacgccaacaacaccgaggccgat
attttgctgcgccaagagctcgacggcttcgtcaaggccttccccgagaagttgtccgtg
cagtacgtccttagccagggggacgagaactggaagggcctcaagggcttcgtcacggcc
gatatgatcaagcagttcttgcctcctgcggcggatagcaccaagatgcttctttgcggt
cctcctcccatggtggctgctatgagcaagaacctggtttctcttggcttcaaggccccg
ggtacgctttccaaggctaccgatcaggtcttccttttctaa

DBGET integrated database retrieval system